KEGG   Paramormyrops kingsleyae: 111837362Help
Entry
111837362         CDS       T05788                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00020  Citrate cycle (TCA cycle)
pki00640  Propanoate metabolism
pki01100  Metabolic pathways
pki01200  Carbon metabolism
Module
pki_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pki_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111837362 (suclg1)
   00640 Propanoate metabolism
    111837362 (suclg1)
Enzymes [BR:pki01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111837362 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111837362 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111837362
NCBI-ProteinID: XP_023655148
Ensembl: ENSPKIG00000010907
Position
Unknown
AA seq 324 aa AA seqDB search
MSHSRLFARLFLQQHGVRHCYSASRQHLYINKDTKVICQGFTGKQGTFHSQQSLDYGTRL
VGGVSPGKGGKTHLGMPVFNSVKEAKQATGAEASVIYVPPPFAAAAILEAADAEMPLVVC
ITEGIPQQDMVKVKHRLLRQSTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPKTEGIILIGEIGGNA
EENAAEYLKEHNSGDKAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQAAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagcaggttgttcgctcggctgttcttacagcagcatggagtgagacactgt
tacagtgcatcccggcagcacctttacatcaataaggacactaaagttatatgccaaggt
tttactgggaagcagggtacatttcacagccaacaatcgctggactatggcacccggtta
gtggggggcgtctcccccggcaaggggggcaagactcacctcggcatgccagtttttaac
tccgtgaaggaggcgaagcaggccaccggagcggaggcctccgtgatctacgtgccgccc
ccgttcgcggcggcggccatcttggaggcggccgacgccgagatgccgctggtggtgtgc
atcaccgagggcatcccgcagcaggacatggtgaaggtgaagcacaggctccttcggcag
agcactacccgcctcatcgggcccaactgccctggcgtcatcaaccccggcgaatgtaag
atcggaataatgcccggtcatattcataagaaaggaaggatcggaatcgtgtcccgatct
ggcaccctgacgtacgaggctgtgcaccagaccacgcaggtcggactgggacagtccctc
tgcatcggaatcggcggcgaccccttcaacgggacgaacttcatcgattgcctggacgtg
ttcctgaaggaccccaagacagaggggatcatcctgattggggagatcggcggcaatgcc
gaggagaacgcggccgagtacctgaaggagcacaattccggtgacaaggccaagccggtg
gtatccttcatcgcgggcctgacagcaccccctggacggaggatgggtcacgccggtgcc
atcatcgccggtgggaagggcggagctaaggagaagattgccgccctgcaggccgccggc
gtcgtggtcagcatgtcccctgctcagctgggcagcaccatgtttaaggagtttgagaag
aggaagatgttataa

DBGET integrated database retrieval system