KEGG   Paramormyrops kingsleyae: 111837943Help
Entry
111837943         CDS       T05788                                 

Gene name
dusp10
Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111837943 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pki01009]
    111837943 (dusp10)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111837943 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     111837943 (dusp10)
Protein phosphatases and associated proteins [BR:pki01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    111837943 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Init_tRNA_PT Y_phosphatase RL
Motif
Other DBs
NCBI-GeneID: 111837943
NCBI-ProteinID: XP_023656196
Ensembl: ENSPKIG00000001920
Position
Unknown
AA seq 466 aa AA seqDB search
MPPSPLDDRIVVPLPRPVRPQELKLCPDTSYLDPISVSGQIAIGTAVVKIRAANLTYMPS
SNGSSRSLSCGCSSASCCTVTTYEKDSQSQSQISVSSPNLSSGVPFAGTPGPMVNNNEAA
SSPASVGILGPGTSATRVIHPNELAKKMTRCPKGHQIGPVPVIIDCRPFTEYNKSHIQGA
LHISCSDKISRRRLQQGKITVLDLISCREGKDSYKGIFSKEIVVYDDSTSDPSRLMPSQP
LNVVLESLRREGKDPLVLKGGLSSFRQSHENLCENFLQLDEGLDSGGATALPPSLPATPD
MENAELTAILPFLYLGNEHDAQDLELMQRLNVGFVLNVTTHLPLYHYEQGLLKYKRLPAT
DSNKQNLRQYFEEAFEFIEEAHQAGRGVLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYK
FVKTRRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLIGVETIV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctccccttgacgacagaattgtggtgcccctcccaaggcctgtccgtcct
caggaactcaaactctgcccggacaccagttacctggatcccatctctgtctccggccag
atcgccatcggcacagctgtggtgaagatccgggctgccaatctgacttatatgccctca
tccaacggctcatcgcgatcgttgtcttgcggatgcagcagcgccagctgttgcacggtg
accacctacgagaaggacagccaaagccagagccagatcagtgtcagcagtcccaacttg
agctcgggggtccccttcgccggcactcctggccccatggtcaacaataatgaggcggca
agctctccagcctcggttggcattctcgggcccggcaccagcgccacccgtgtcatccac
cccaacgagctggccaagaagatgacccgctgtcccaaaggccaccaaatcggcccagtg
ccggtcatcatcgactgccgtccgtttacggagtataataaaagccacatccagggggcg
ctgcacatcagctgttccgacaagatcagccgccggaggctgcagcagggcaagatcact
gttttggacttgatctcctgccgggaaggcaaggactcctataagggcatcttctccaaa
gagatagttgtttacgatgatagcactagcgaccccagcagactgatgccatcgcagccc
ctcaatgtcgtcctggagtcactcaggagagaagggaaggaccccctggttttgaaagga
ggcctgagcagcttccggcaaagtcatgagaacctttgtgagaacttcctgcagctggat
gaggggctggattcgggcggggccactgccctgcccccctccctgcccgctacgcccgac
atggagaacgccgagctgaccgccatcctccccttcctgtacctggggaatgagcacgat
gctcaggatctggagctcatgcagaggctgaacgtcggtttcgtgctcaacgtcaccacg
cacctgcccctctaccactacgagcagggcctgttgaagtacaagcgcctccccgccaca
gacagcaacaagcagaacctcaggcagtactttgaggaggcgtttgagttcatcgaagag
gctcaccaagccggacggggcgtcctcattcactgtcaggccggcgtctcacgatcggcc
accatcgtcatcgcctacttaatgaagcacacttggatgaccatgacggacgcctacaag
tttgtcaaaacgagaaggccgattatatctccaaacctcaactttatgggacagctgctg
gagtttgaggaggacctcaacaacggcatcaccccacggatcctgacaccaaagctcatc
ggggtggagaccatcgtctga

DBGET integrated database retrieval system