KEGG   Paramormyrops kingsleyae: 111838565Help
Entry
111838565         CDS       T05788                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111838565
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pki04131]
    111838565
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pki04812]
    111838565
   04147 Exosome [BR:pki04147]
    111838565
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111838565
Protein kinases [BR:pki01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111838565
Membrane trafficking [BR:pki04131]
 Others
  Actin-binding proteins
   Others
    111838565
Cytoskeleton proteins [BR:pki04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111838565
Exosome [BR:pki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111838565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase Ig_6 C1-set Pkinase_Tyr Izumo-Ig THB Titin_Z Ig_4 bMG6 Kelch_1
Motif
Other DBs
NCBI-GeneID: 111838565
NCBI-ProteinID: XP_023657438
Position
Unknown
AA seq 30934 aa AA seqDB search
MSTQAPTFIQPLQSVVALEGGAATFEALISGVPVPEVSWFRDGQVLSAATLPGAQISFSD
GRAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTVETAPPNFIQRLQSMTVRQGSR
VRLDVRVTGIPTPVVKFYREGAEIQSSADFQIVQEGDRYSLLIAEAFPEDSGTYSVNATN
SSGRATSTAELLVQGEEEAIPAKKSKTVISTAQISQTRQTRVEKRAKAYYQATATTMMEV
HVDEGDTAQQLLHKAPPSVAPKPTSKSPTSSLVSKVAGARQQSPSPVRHIKGPTPPPVRS
VSPSTRLSVSPIRPVKSPLMTRKQITPGSDVLPPWKQGDYVAESSYTSMIASASRVQTST
TQVQMEQRWEGYGVQQQVTGIVAKEAEGGKKAEAVATVLAAVDLARIRKPAQAEEGHAEE
EILEPDLKRQALDTQASKMITMTMKTEALQIPSSSQIASDEHRVQVSQIQRSTETTTTHV
DTSLAPSPIPHFTVSKVTVPKPDHSYEVSIAGSAIASLHKELSSTSAAQKIIRPVKPPSH
KIVEMKAKQEPTPSPFKDTSERFQMHFGTLSQTEIGTSFTGGMEQIHEQWEKQAVEASTI
TIPAQETVAPPTLVIGLKNVTVTEGESVTLECQISGHPTPTIMWFREDYRIESSVDFQIT
YETGYARLVIREAFAEDSGRFTCTATNQAGTVSTSCYLLVKVSEEIDSKDTFPAAHVSLN
GTEKPWPVEAKEEILELTTSAEAMAPFFVKKPIVQKLLEGGSVVFECQIGGSPKPHIYWK
KAGVPLTTGYRNKVVYNKDSGECKLEISMAFADDAGEYTIFARNQLGEASASTTLLEEAE
YETYMKMQEITFKTEMTTMVQEPKVADVPPAIISEYEKEEILMQKRMAQQMQTMKTFMTE
QEFQISAYEERIILEIEFYIVRISYQELVNEDGEEIIMNISEHEAIAPTFYTPVKSYRVL
EGMGAAFHCRVGGNPLPKIAWYKDGMRIKHGGRYQMEVLQDGRASLRIPVLLPEDEGVYT
ALASNMKGNSVSSGKLYVDPATTAVAQSYYLQPDAISRISSTSPRSLSRSPGRFSGRSPT
RRLDETDESLLERLYRPVFLVKPFSLKCSEGETARFDVKVVGRPMPETFWFHNGQQIVND
YNHKIAVKEDGTQSLIIVPAMPHDSGEWTVVAQNRAGKTSVSMTLTVDAKENLVKPTFIE
KLKNISVKEGTLVELAVRAIGNPLPDIVWLKNSDIISPQKHPHIRIEGTKREAHLKISSA
TGTDSAWYTATAINKAGRDTTRCRVNIELEFPEPEPERKLIIPKGTYKAKEIAAPELEPL
HLRYGQEQWEEGDLYDKEKQQKPHFKKKVTSVRLKRFGPVHFECRLTPIGDPTMVVEWLH
DGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVVTCRATNKFGVDQTSATLIVKDEKGL
VEETQLPEGRKGMQRIEEMERMAHEGALAGVTAEEIFEKTKPEIVLLPEPVRVLEGDTAR
FRCRVTGYPTPKVNWYLNGQLIRKSKRFRLRYDGIYYLEITDCKSYDSGEVKVIAENPES
VTEHCVKFEIQQREDFRSILRRAPDLKTPESGPSPDRGRVSFEVQKVDAPADTTQPKEII
KLKKAERVVHEISSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEDMLRKKKEE
LLHWIKEISDKEKKMEEERGKVTIPTIKPERIELSPSMEAPKILERIQSQSVFPTDEVRF
RVRVVGKPDPECQWFKNGILLEKSDRIFWYWPEDNLCELVIRDISIEDSASIMVKAVNVA
GEASSHAFLLVQVKQIVSFTQELEDANAKEKDTMVTFECETSEPFVKVKWLKNNVEIFSG
DKYRMHSDRNVHFLSVLIIEMKDIADYSCCLVDDDHIRTTARLTVEGAPLVILAELENIE
VPETYSGEFECEVSREDAEGTWYFEGREISPSSKYIISSRRGRHSLFVKDVRKEDQGKYS
FLVGDLKTTASLKMKLRPVTLVQGLADLTICEGDIAQMEVKFSQENVEGKWMRNGQAILA
TDHIHMVTDKLTHRLLIEDAQGSDAGMYSFFVPAHYLTTSGKLTVQTISILTPLKDVTSV
ESTKAVLEAKISSADITSVKWYHNDKLMMPSERVQFVAKGYKQRLVFDRTFASDEGCYKL
VVGKAESSCNMTIERVHIIKHMEDQICPETQNVTFEVELSHPGIDPVWSFKNQPLILDAK
YRMEAKGKRYLLTVINTMKDEEGQYTFAAGEMTSSAKLTVSGGAIKRPLQDVTVAESQTA
EMECEVANPSIEGKWLKDGKLLQFSNNIKSKDFGAIRKIIIVISRPQDIGEYTYQVANSK
TTANLKVEAVKIKKTLKNQTITETQDAVFSLELTLEHVKGAQWIKNGVEITPSDKYEIQV
DGMVHTLKIKNCTAQDESVYAFKLGKLSANARLNVETIKIMKKPKDMTSVRDATASFELS
LSHDNIPVKWMFNNAELKPSENCKILSERKAHKLIIQNADTHNAGEYTAIVGHLQCSASL
FVESLQITKTMKNVEVPETQVATFECEISHFNVPSTWLKNGVEIEMSEKFRIVVQGKLHQ
LKIMNTSREDSAEYTFICGNDRVSATLTVNPILITSMLNDLNAQEKDTITFEVNVNYEGI
SYKWLKNDVEIRSTERSQIRSKQLSHSLTIRNVHFGDGGEYKFVAGSASTSANLYVDARV
IQFTKFIKDIKTTEKKKAVFECEVSEPNVQVIWMKDGLELDKSERYKISSEKYVHRLIIQ
NVWLSDAGEYCVVAGSSTCKAQLTVEGRDVRITEPMEKEITIVEKHKAAFEFEVNEDDVE
GCWLRNGIEIKFSVEDRFNYVVIRKVHRLTISETCHSDAGEYTFIAGRNRSVVTLNVNIP
EPPQIIQHMQPLCVEAGKPACFSVVVTGIPRPKVFWYKNSQVLSPGFKCKFLQDGNEYKL
LLIEAFPEDAAVYRFEAKNECGEATSTADLIIEVPEVISPDTGSPLSLPVIISPICNTTV
GVGETAQFQCRVSGEDLQIIWYCKDREIKQSDIFRMSQFDDKCQLEITRVFLEDKGEYTC
VARNPAGMVSCSAVLSVDVLKMGEQIEPKTTQAATAFSSLTFTNEEKQESTGTSPYLTEK
TETLELKPESRFDPVQLENKKEKPVFVTRLMPTNVTVGDTAKFTVTVSGFPKPTVEWFHD
GQMITSSSVYKLVQEKDEFTLIISQVKVEHKGQYSCTATNSYGHSTSSTFLHVHIEERRK
ILQKPPPRFILPIASLQCIEGGEAQFQYNVTGEPLTEVKWFKGSHQIQPSSHYTIQKNPD
GFGYLQLHGLQMEDSGLYTCQASNPFGDASCSAELIVCHKSQTYNEEHSVYQTQKGYKIS
MTEEATESRLYTVNLPGEARACLQSGHKMLYTIGTEDKQTVISEQVGTLQETNVSAANLQ
REQITRQAALLQSHKLEERVSVAPTQPPSSTVAPVRQLNVPTFTSAVQESQGFIEQHYDH
IQSPVIVELKMAQERHANIMSAVTEKITPLNSIETELMGNKKREQIQVLSHQVETRLPIV
DEQSEVISKPEFEQSYRVKEGVKILYSALATEKQKLSEAHSTEWSISEASTQSSTGKEMF
KPVLASVTEIKNLLSKEDKYDIHRLKEAKAVPCKDAVLKSSLVSEEKQILQAEQTKQIPD
LEKALTVQSQKEKREIMHLQIMRDQGTLPSDGRIICEKPIAEQTDIIKQPTLLHTVTTNE
QNSVTCDLSSQFSSKEIQYSVQPTKESLTPLHLQSVHPECVLAKEEILTVEKPEEQISLS
KQERVRRQAVSIEEKRKLTADYSTNIDGSITGVCSVLKTEPKPQNILQVISKPVELPKET
PFTTVVKQQRALVQKEDQWALMHLMTTEDSQTLQEGHTNTLNVVEKFSCEAKVEPCIPCE
PVNIEEKAISTERSVALEAAEQDFAVKIQEGQSVRKSVVMAENQVIIGEVSQEINKSEAN
KACSIKQSKEVLTVHETQESTVLPKELTFIIPTSKSFSLDIKHQLKHALQSAVACEQPLL
LAEVVNSLEVVEVKEVKMLKAPKYAMFTYLITTSSTPLEITVAFDGDYPQTADLRNELQS
TLYSMIYHDKPVLTSEEPGIKEIDKPLRLRVSSTSSKEMLSSLIETVGFSEMVGDFSAAK
PQSAALKVESHASFETVKAHQSTDVSLAQIPVDQSIERYGGEFLKHAVVAESPIRITKDF
PVIETFLENTEVEEHSMVSFTVIVTSVTNVNWYFNGQLVKSGKEFKCYKDNDNYTLVIDK
VIKEKHQGEYVCEAVNKAGKSSTSSKLTVFLRVPPVFLHKIQPLEINVGSRARFECEIEE
APNVKFKWFKSGSEMRDSDKCRIISHHLSSSMELLNPTKAESGEYTCKATNKYGSDSCSA
SLNVAEVFPPVFITKPDPTTSYVGKQARIQCVVTGSSPMNVVWQKDNVAISSGGNYQISA
DKNRHTLEIVKLALSDQGTYQCKASNVVGTDMCGTELRVIDKPNFVKTFTSTSVALGKPL
RLECQVDEDTGVVITWTRDGKKLHHSMDLKITFEDKVATLEIPNTKLKDSGKYSCTAAND
AGSDCCSSTVSVQESPTFLKRLEPKILWKQGITGRMQCTVKGSPELHITWFMNDKEISPG
EKHKMSFKDGQAVLEILNLIVTDSGNYTCEVLNDAGCESCSTVLTVKEPPSFKKELQMVE
VVKGTTAVFECEVTGTAPFEVTWCKNKKPISSDKKHNIISNYSKVILEIYSFESVDIGDY
QCFVSNDVGKVSCKSTGKLKEPPTFSKKIENTSAIVGNSVRLQGTLKGSSPITVKWMRDS
EILTDDDPNVIMTFENNVAVLAIKTVSINHSGKYICQAENDAGKQQCEATVSVQEPARIV
DKTESISVTAGEPVSLECTLSGSPELKVKWFRDGKEVTASRKYKMTFKDNVAILKILTAE
KGDSCEYTLEVANRVGKDQCTCSVTVLEPPIFIMKPDSQEVIPGSTVVLQSAFTGTSPFT
IKWFKGEKEMFTGGSCFIKKESTSSFIELHSVKPTDSDNYTCLVANDAGKVTCTGVLFVK
EPPKFVMTPESAKLVTCGSAVILECRVIGSPTISIKWFKNEAEISSDDKYQMAFSNSVAT
LQIANCSVDNSGDYVCEASSEAGSDRCNSVITVKEPPTFVKAIESKEIVKGSDVILEGII
SGSSPFEFTWYRESKIVRNDKTHKISLHNDTVSLHILKCEVGDAGIYQCIVTNEVGRTSC
DCQVSLKEPPSFIQKIENVSSVVGHEVTMQCVVKGSLPITVSWIKDDREVKEDENIKISF
EDQTGKLHITNMQLKHDGKYICLAKNEAGSQKCSASLVVKEPANIIEKAKSISVTAGDPA
TLECSFSGTKTLKARWLKDGRELKSGQKYKVHSTDKHSALKILSADKSDGGEYTFEISND
VGSSTCEAVITVLDHIIKPSFTRKLKAVDSIKGSFAHLECLVSGSLPIIVSWYKDNREIE
TDDKHKCTFFENTAFLEISRLDSSDTGSYTCIANNQAGSDQCSGALLVKEPPSIIKKPES
MDVLPGTKVQFSVLFSGTTPLTIKWFKDNKEILSSSHCSVQKDNCSSLLELFFAKTSDSG
DYFCEISNDIGSEVCKASLFVKEPPKFTRKPESTAVIKLGETKKFDCQVVGTPEIYITWF
RDGNEISPNEKFKMSFDNSLVILEIFNADIKDSGVYFCEARNEAGSESCSMELKVKEPPA
FIKELTPLEFVIGYDVSLTCQVTGTSPFEVTWKKDAKEIISNKRHIVSQCNDFVILEIFK
CEALDVGEYQCTVANEVGRCSCTTVLSMKEPPSFVKKIENIAIVLGKIAEFHCVVAGSPP
LTVQWQKDEDWIIEDANIERKFEGNVASLRIAVSEASYSGRYTCQVSNEAGQEKSFATLV
VQEPPQITEKPETVNVTAGDPVSLDCKVSGTPELKVKWLKDNKEITSSRYQKLSFVNNVS
CLKIQSARIEDGGDYTFEVTNDFGVSSCKVTLVVLEQLIAPSFLKPLREMQEVLGSYVKI
LCRFSGSLPISVEWQKNGIIITGKTRYKLAQEENTVYLEIDQLEKADGGEYICKLTNKAG
FCECQGLLMVKEPPSFMLKPESQAVLPNSSVRFKSTLKGTPPFIVKWFKEETELITGPSC
FIGLEGLSCFLDLYAVQVSQSGIYVCQVSNDAEPPKFVLKLPPTKFVKQDEPVLLECKVT
GSPLLRIFWYKNENMVAAGGNCNMSFVDSLAVLEIPTTKLEDSGVYTCEVQNDAGSISCS
TALTVKEPPSFLKEPQPVDGVKGRNVSLECELLGTAPFEITWYKDKKTLKDSRKYKFVNE
GCSVTLHILNLEAFDVGEYQCKASNNVGSATCTGTVKLREPPAFVKKLSNLSVICGEEAM
FAASVKGFQPMTISWVQDKDNVLRDGENHKISFEDNQITLRIFKTDVLSSGKYICQVKND
AGSVESIAKLTVLEPASIMDKLESFSVTACDTAILQFTVAGTPELKPKWFRDGAELSSGQ
KYKITFSKMISTLKILSAETKDTGEYTFEVSNEVGSDTCKTYLTVLDKILPPTFIRKLND
TRMILGKPGQMDCKVSGSQPLTISWFHDGKEIVSGPNHEVTFSDNTCLLNLPSLKLPDSG
MYLCRAVNSAGASETSASLFVREPPSFIEKPQNMEVLPGTNITFSATVKGSAPLKLKWFR
GSAEIVSGKGCAIALRGDTATLELFQIAKSHAGDYTCQVSNDAGMDDCSVNLFVKEPAYF
VKKTKDLAVEIGKMLLLECAYAGSPEIQVKWFKDDNEIFSSYKYNITTTESSCILECLNT
DKDDSGRYSCQVFNEVGSDSCHAQVSILEPPYFIEKLEPMDVTTGDAVCLKCHIGGTHEI
KVSWFKADGKLRSSAACKIEFTRGIASLKLSKAVQTDADEYTCKAENSIGSASSSCRLTV
QDVKTPPSFPKKIMSLQQTEGQPARFECRIAGSSPLEVSWLKDGEPLKENDEYSMYFDDN
TAVLTISRGEIKHSGEYTCVATNSVGTASCRAKLTLQEPRYPPVFDKKLQPVEVSVGDSV
DLECHITGSLPIKVTWSKDQKDIRAAGNYKISCVDNTPHLTILKADKTISGQYYCHASND
IGKDTCSTHVSVKECKIPPSFKRTPSESIEDSEGNLVKLEGRVSGSQPISISWYKDDSEI
YSSDSYEISFKNNIALLSIKRAQLSDRGTYTCQASNEAGTASYQVSLAITERKMSPVFDQ
PLKPLSVNEGEKLHLSCHVRGSLPMNIQWMKDRKEITSSAKTRITFVDGTATLEISSASK
TDAGDYLCKATNDAGSEFCKARVAVQVAPAAVDGVPATAEQVKKTDNLFFIDEPKSLSVT
EKGTATFFAKVGGDPIPTIKWMKGKWRQISHGGRITVEQKGQDAKLEIQALTKSDSGQYR
CVASNKHGEIECSTELKVEEKKEAALLEGDLRAKLKKTPSKQKSPKEDQDIDIVELLRNV
NPKEYEKYARMYGITDFRGLLQAIEYLKKEKEYESGKLEFELGERESVEDFAKLVSDLQR
RMEHTEPITLLKDIADQTTLTNKDAVFECEIKINYPEISLSWYKGTQKLDSNDKYEISAI
GDCHQLKIKNCQVGDQGNYRIVCGPHISSAKLTVMDDRVVEHSKPADQIHFTKRIQNIVV
NERHSATFECEVSFDNAVVTWYKDTWELKESPKYSFRTEGRRHFMVICNVTSEDEGVYSV
IARLEPKGEAKSTAELYLSSKEFYIGMVPCDVLDPSIQVPDVQSDISPGETKDETVSYRY
KEKIEMQEFESWAVYEERIIEETTKASKIAITETVPTVAIEMIEEVPRRVHALEVESEPE
ITVPVILTAPTSTKEHEELKKFIPCPTPAPTTHPEDGLTPAVSEPKPAVTPKGQAKTVAP
AKTEPKPTPATQAVPEPKPTPATQAVPEPKVYESAQQFFEEKEILIVEDVSPASREEISL
KTEEIPRQKETLQETEETVPKKVLPYKKEEFTTKQERVPKTEALPDKEPDKITIPEVTPV
SVKDIAPPEGKIYVDEEKMELLSLKKITRISKGEEEEKEVVTLRKVPRAPADEIPKTSSH
AEKVIAYSESPREITFTKSFEVKEETSKTEETSKTIVKIHSREEREFIEVVQIKELKETT
TTDGIVESKLHLNKVPTDEREKEGLGLKKSVKVVKEETPEEPMLTRKKISRLPKTDTDKE
TVTLKPFEKPAKPEIEKEKDKEEEPLTFIRTERLPKDDVVMEPISSKKVESVLVKEGGRE
EDRESLVLRRPQKDEADKEPVAAPKKAEAVLVTEREKAFKVMTKEAPEESSSTMKKISRL
PKTDTDKETVTLKPFEKPAKPEIEKEKDKEEEPLTFKKFEKPPKDDVVKEPIAPKKAEAM
LVKEKEKEKDKDPLAFKRLQKDEAVKEPDAAQRAKAVKVAKEETPEEPSSIMKKVTRLPK
MDTDKETVTLKPFEKPAKPEIEKEKDKEEEPLTFKKFEKPPKDDVVKEPIAPKKAEAVLV
KEKEKEKDKDPLAVKRLQKDEAVKEPDAAQRAKAVKVAKEETPEEPSSTMKKVTRLPKTD
TDKETVTLKPFEKPAKPEIEKEKDKEEEPLAFKTIEKPPKDDVVKEPIDPKKAEAVLVKE
KEKEKDKEPLAVKRLQKDEAVKEPDATQREKAVKVAKEETPEEPSSTMKKVTRLPKTDTD
KETVTLKPFEKPAKPKMDKEKDKEEKPLAFKKIDKPPKVDVVKESIAPEKAEAMLVKAKE
KEEDTEPSALKRSQEDEAIKEHVAAPKKTETVSVKVKEQSVEVAKEKTPEAASLRLPIKD
TDKEAFHFKGTETPPKDEVKEPGAGFRKTEKILEDKKEQEKRTLEPPEKPPELDKLSTKL
KTPSIDEQEREKVELKPFSEAPKPEVLKAVPLKADKISGKDVPLKMTTHLPKEPDEGEQE
ILLKPVEVSKVGLELRKSPSLKVEKPVTVELTPVERKSSVDTHKTLPKKVSPKDSIDSVT
LKTIPKKTSPPEEKTPEDTRLKFGKGMTLERKELSPQFVQLRSVPTQQEDEVSKEEPDKQ
VEDEGKILGSELSSHESYSSYGSEDWEVTSQVSEEGALETPGMKGDRRDGKPKEEPGKGR
GLLARQTPSPGDADKRKGMKTGAGGDKPPGDAPFGFQLKAVPLKFVNGLKDIVLQEAESI
GSSAVFECQVSPSTAITTWMKDGSNLRESPKHKFTSDGKDRKLAIIDVQLSDTGEYTCVA
KLGNKEKTSTAKLIVEELPVKFTKNLEEEMSVLKGQSLYLTCELNKERNVVWKRNGIPLQ
PIPGKIAINVIGLQHSITIQNTENEDVGIYSCEYENLKTQGDIKIIEIIRDWLMKPLRDQ
HVKPKATATFKCELFKDTPNWKWFKDDDEISKEPTDKTEVNKDGRNISLMIKNAAPDDVG
EYTIEVEGHRYPAKLTLGEREAEILKPISSVEVFEKENATFETEISEEDVAGEWKLKGQI
LTRSPTCDIKMEGQKRIITLKTLEVDQSGEVSFQALNAITTAGLTVKEIELDFIVPLKDV
SVPEKKQAQFECTITRDIAKVMWMRGSDIITSGIKYDIIDDGKKHMLVINDCEFDDEDEY
TIEVLDKKSTAKLTVEGVRLKFITPLKDQTVTEGKTARFELELSHEDVPVTWYKNEIKLH
PSRTVLTHVDGKKHILEIKEVTLDDTCQIKAEAKGVSTTANLLVIEADPYFTVKLQDYTA
GEPYFITKLQDYTAVEKDEVVLMCEVSKPAAAVKWFKDGKEVTPSKNVLIKSDGSKRVLI
IRKAQKDDIGEYICDCGSEKTTAQLDIEEREIMVIRPLSSIEVTEMESARFELDISEEDV
HGSWKLRGETLHQSADCEMKAVSTRHILILYNVLRNQAGTVDFQAANAKSSAHLKVKARV
IGLLRPIKDVTVTAGETAAFDCELSYEGIEVEWFLRNIKLESSERVVIRMDGRVHTLMLR
DTALTDAGVVEIRAKDFVTQAQLIVNEPPVEFTKPLEDQTVEEEATAILECEVSREKAEV
RWFREGQEIHKTKKYDIVTDGRKRKLIIQGCTLDDSKTYTCDAKDFKTSAFLNVEPPHVE
FTKPLHDVEVKEKEAARFECEVSRENAKVRWFKDGSEIRKGKKYEIIAKGVQHILIVNKA
VFDDEAEYECDAKTSKTSGMLTVIEEEAAFTKNLSNIEGTETDSIKMVCEVSKPSADVTW
YKGEQELPEGGRYEQIVDGRKRILIIRDLCMDDTGEYNCRLPSSRTSATLRINELAADFI
SRPQSQEVVEGQKAEFVCSVSKDTYEVKWLKGDKELEAGEKYDIVCDGKRRALIIKDCLL
QDEGPYVALIGTTRATAELFVIEKLRIITPIKDTETDEGQEIVFNCEANTESAKAKWLKN
NETIFDSGRCVMSQKDNVFSLRIRDAQKSDEANYTITLTNQRGEHAQSSAQLTVQEEDLR
IIEPLEDCETQEKRTVTFSCKVNKPNVTVQWMKAGEEITFNKHISYRVDKDKHMLTIKEC
SLADEAEYSVIAGSDKSTAELIISEAPTDFLTKLVDQTVTEFEDAEFSCMLTKDKGEVKW
YKNGREIKEGPRYFFEKEGEMCKLHIKECRPDDECEYACGVNEKRIRARLFVEEIPVEII
TPPKDIFEAPGSDVIFEVELNKDRVEVKWLRNNMVIVQGDKYQMISEGKVHRLQVCEIRP
RDQGDYRVIAKDKDARAKLELAAVPKVKTTDQNLVIDAGKPFTMIVPYDAYPRAEAEWFY
NEIYLPEENIDTFTDRTEYKLNEPEKSDQGRYKIIIRNKHGKAEAFINLEVIDVPGPVQN
LDVVDTADGEVSLAWDEPESDGGSKIIAYVVERRDITRKSWTMVTNRAEDQEFCVTGLNK
DSMYLFRVCARNRVGNGPNVETENPVQAKNKFDVPEAPQNVNVRNVNKFGATLSWEPPLY
DGGSEITAYIIELRDRTSVRWEAALVTKPEDCTAVINDVVENKEYIFRVRAENKAGIGKP
SFATDPVKIMDPIERPSPPLNFSYTDQTRDSIQLTWETPLSNGGSTITGYIIEKCEDGTD
KWFRCNARLCQDLSYKLTGLKQGHKYHYRVSAENAAGVSDPADQIGPLVADDPHVAPTMD
LSAFKDGLEVIVPHPLIIRIPITGYPLPTPHWSVGDKELAAGDRVSMVTKSTFTELIITP
SVRPDKGIYTIHLENDAATISGEIDVNVIASPSAPRDFKVAEVTRRHVHLMWEAPEHDGG
SPLTGYQVEKREASRKTWVKVISGIQDQEYSITDVTEGKEYLFRVTACNKCGPGEPAYIE
EPVNVSSPATVPDPPEDLKWRDKSANGIFLSWEPPKYDGGSVIKGYIVDKCQRGTDKWEP
CGDPIPELKFQVTGLTEGQWYAYRVRALNRLGASQPCRATDEILAVDPKEPPEIMLDVKL
LAGLTAKAGTKIELPAGVLGKPEPKVTWTKADVVLKPDDRVAIDTKPGHSMVSIAKTTRD
DTATYIIEAVNSSGRATATVDVNILDKPGPPAAFEISDITNESCFLAWNPPRDDGGSRVT
NYIVERRAADSETWHRLSSTVKQTTFKACNLTSQKEYIFRVFAENQYGIGLPAEHVPVVA
KYSFDPPGAPSKLVPSDIAKDSLTLTWYEPDDDGGSPITGYWIERYDPENDKWIKCNKMP
IQDTSYRVKGLPTKKKYIFRVLAENLAGLGKPSKETDQILVKNPIDVPWAPGKPVIKDVA
KTSALLQWTKPEHDGGAKIDSYVIELLKSGTEDWVRVAEDVPMTEHFLKGLMEKEEYSFR
VRAVNSAGESEPSEPSDTVTCKERLYPPSPPRWLQVVNITKTDAELKWTVPEKDGGSPIT
NYIVEKRDVRRKAWQTVDTTVKETKHTVTPLNEGSLYVFRVAAENAIGQSEYCELEDSVL
AKDTFTTPGPPYALIVLDVTKRHVDLKWESPKNDGGRPITKYVIEKKEKLGTRWVKAGKT
QGPDCTYQVTDVDEGSEVQFQVRAENEAGVGPPSEPTDVLRIEDPISSPSPPLDLNITDA
SRHHISISWKPPEKNGGSPILGYHIELCEAGTEKWMRVSSRPVKELKFTAIEGIIPEKQY
VMRVRAINAIGISDPSDVSQSIYAKDPDCAPTLDLITEDIIAIEGDKLQLPVPYSAVPLP
TVSWKKDGTDLKADGRVSLHCERSAARLDISKCVRADAGVYAITLENRLGTISGTLNVKV
IGIPGPCKDIVASEVTNNSCKITWEPPEDDGDSPILHYVLERREASKKTYRPVMSGETLS
CIVKDLLVNAEYYFRVRAVNKVGSGEYIESRNPVIIEDQKDRPDPPTKVEAHNVTAHSVT
LTWKPPISDGGSPIKGYILEKITKDGTRFERCNEILVPGFSYTFEGLKEGEEYQFRVRAE
NAFGISDPSSTTPLVKAADPVELPKVSLIGSLSFKKGEEITIDAYISGSPYPTVTWFRND
EVIKLETIKKPVKPTMKKKSKAAYSEPEEPYHPPLNERVSFDPSKKGVAIVMIRDCVRSD
HGVYMANVENVHGSATASCDIIVLDVPGPPVNFTFEEIRNTSLICKWDPPKDDGGSEVLN
YILEKKDNTKDDGGWITVTSTCKGCKYPVTKLIEGKEYLFRISAENKFGPGPACYSSPVI
AKNQFDPPDAPNMPRVGEVTENSMLVSWNEPKDNGSPVLGYWIEKREINSKYWTRVNNNL
LNSLKVRVTGLLDGMTYIFRVCAENLAGPGNFSVPSEPKVAQDPILPPGPPVPRIVDTTS
SSIELTWKPPLYNGGGDILGYHVEKVLAGEKNWSRCTERLCKDCKLTISGLTEGADYIIR
VFAVNQAGEGAPGMTQPVMVKEPQETPFVELDISVKNGVTIRAGETLKLPAYVNGRPQPE
VKWTKDESDPVKEHVMIETIGKNSTLSIKNALRSDHGIYQITGSNSSGTKSAFTRVEVLD
VPGPVIDLKTNVVTKKVIALSWSEPADNGGSDITSYTVERRDAKMHTWRQPIETPMCKCE
IRGPFDGGEYMFRVVAKNKFGCGEPVDLGPILAIDPKGTPTAPERFRFTERTKSSITLSW
KPPQSDGGSPIRGYYVEKKRKDGTEFEIANRQICKDLFLTLENLSERHMYDFRVKAVNDI
GDGEPSLTLSAVIQDDEVKPTVTLLKYFKSGTITAKKGEAIEIPAEVIGIPMPKSEWSRD
GNIIEEQTEKFLINTEVLSYSKAHTTLSIPETDRKDSGLYTLTASNHLGSAYENIKVEIF
DRPMPPQNIVVSDITNQGCYLTWDAPEDNGGSELTNYIIEKRDASKKKSDWEEITDSVIE
RRYRVSKLETDRTYQFRIKAENKYGVSDGCESEKVIVKDLYGLPGPPQNPKIAGCTRTSM
LVTWEPPKDNGGSTITGYWLEKREKGAVYWNRVNRAPITKPAIKGLEFNVHHLNEGTEYQ
FRVMACNAAGVGPPSEPTESAFATDPKNPPGMPSSPEVAHKTDDSVTLTWNPPDKDGGSP
IKGYIIEVQDEDSLQWRRVNESDKPHPDNKFTVPDLQKMKKYKFRIIAVNSGGESEPSPG
TSHILVKEILEEPRITLDINAKELLSCRAGSTIKIPAIITGCPTPNVTWQYDGKAISEKK
EGLHFLPVESQIRSIDTTSTVTIPDSTLCHSGTYIISAENKAGQKAVKVRVNVLDLPGPP
KDLKVSDITRGSCRLTWKPPDNEGGERIKSYYIEKKTVEGKAWTKVNPACGSQSFVVCDL
IEGQEYLFRVRAQNSLGLGPHTETIQRTKARDPIHPPDPPIKVKINQVTKDTVTLTWKPP
INDGGAPVTHYIVERLCWDTSITQKESWRQCNRRDVEETTFKIEDLNEGGEYEFRVKAVN
EAGASRPSSTAGPVTVKDQKCAPSIELDTFMEVEQGTDIKIVAKIKGCPFPTLTWQKAPP
YRKDEKTDVEYDEHINKLVTDNTCALLIKQGKRADTGIYTITASNSLGKASKEIRLNVLG
CPGPPCPPIKFEEVSSGKITLSWLPPKDDGGSKITNYVIEKRVANRKTWIHVTNEPKERV
YTVENLIAGHEYVFRIMAQNKYGIGDPLDSEPEKARNLCTVPGQCEKPTISSVTHNSMTV
NWEEPEYDGGTPVIGYWLERKETTSKRWNRVTRDPIKVMPFGVSHNVSGLIEGSQYQFRV
TAINAVGCGPPSLPSDPITATDPAAPPDPPIPKVTDWTKSTVDLEWVPPLKDGGSKIIGY
IVEYKEEGQEEWGKAKDKEVRGTRLVVDGLKELGHYRFRVRAINTAGVSQPGEVPEVIEL
KDRIIAPEVNLDATMKERLVVHAGGVIRILAFVSGKPAPQITWNRDDGALPEEAAIETTA
ISSSLVIKKCTRKHKGIYTLTAKNDGGEKKKSIVVDVLDIPGPVGVPITAENLTSDSCKL
NWFYPEDDGGSAVTNFIIQKREAERKAWTPVSCTITRHAAVVRGLVDGKAYFFRIAAENM
IGIGPFTETTSEITIKDRFSVPDRPEDLEVTAVTKDSITLTWKPPKNDGGSEITMYVVEA
RPIGKEKFVRLTKEKLLGRKFTFDGLKAGDTYEFRISAVNEIGQGKPSFNTKPITCKDEL
EPPTIELDFRDKVIIRVGESFALQGRYTGKPAPSIIWFKDDKELQADNHIKLKNTLTTMC
LGIIKAKREHSGRYCVLVENCTGSRKGICNVTVVDRPLPPQGPVLFKEVHRDFMVISWKP
PLDDGGSEISNYIIEKRDTKRDLWATVTSASTKTTCKVPKLTEGREYIMRICAENMYGIS
DPLESEEMRAKDLFRVPEAPEQPVVKEVYKDTALVNWSRPRDGGKPITNYILEKKETTSK
RWSRATREPIYPDTQFRVQDLTEGCEYEFRVMAENEIGVGDPSPPSNPVVAKDPIVPPSP
PVLPEAVDKTKETVSLTWQPPRHDGKGKILGYLVEYQKIGVEEWKKANETAESCPETKFT
VQNLEDGEMYRFKIMAVNAAGKSDPAYVKDPVKVHDRLEPPELLLDANMAREHLAMVGTD
IILSAGIKGVPFPKVTWKKNNEEVPPRANVEVTGVGSKLQIHNCLRSDCGDYTISVENSA
GSKAATCTVLVLDKPSPPRNLSVSEITRESAYLSWNEPEDDGGAVISNYVIEKRDVASDN
WVPVSSSCKKPSLKALYLMEGNQYMFRVAAENQFGRSEYISTTKPIKAIDPLYPPGPPKN
LHHVDADKTEVWLQWNLPDRTGGSDITGYLVEYQEEEEKDWITFKTVKKTECHVTGLEEG
KTYRFRVKAENAIGLSRPDTTVPILCQEKLVAPTIEVDVKLIEGIVVKAGSTIKLPAIMK
GIPVPNPKWVTDGKEIKSEGNVLIKTDHYSTTVTIKDCKRQDTGEYLLTVSNPAGSKTVA
LHVTVIDVPGAPTGPVNMLEVTPDFMVINWRPPKDDGGTPLMNYIVEKKDTKKPWEPWAV
VSSGSINTKAKVSYLEKGREYVIRIRAENKVGIGAALESSPTIAKRMFDPPSAPGQPVAQ
DITETAVTIQWEAPLSDGGSPIIGYIIERREMTGKWIRLNKTPVLDTRYRASGLFEGNTY
EFRVFAENIAGISEPSPVSDPVKTTRPITCPGPPVNVKLKDWSKSYADLVWTKPSRDGGS
PILGYIVECQKSSSKQWDRINKDELIKPCAYRVPGLIEGMEYKIRVRACNKIGEGEPKEL
SETVIAKDILIPPEVIVDVACRDLLTVRAGQNINLVARVKGRPDPEITWTKDAKVLVQDK
RTEMNNNYPLVDMIIKEATREDYGKYVIQAKNISGQAQASIVVNVLDKPGQCQNLKISYV
TKDSCMVSWENPEDNGGTEITNYIIECRQPNQRGWTVVSSDCTKRLVKALLMENCEYFFR
VSAENKCGQGPPIETKMAILAVDPIEKPGEPENFHPAEIGKTFVFLKWKKPEYTGGSHNL
VYHVERKLKGAEEWERLHKGAIKETFFMVDRCIENQIYQFRVQTKNEGGVSNWVTTAETP
AKEELLEPELGIKLDGVLTVKAGNPIKIEASLKGKPQPVVKWLKESDTGDINKSPRCHTE
TGSDFSKLLMTSSRRTDSGKYVGTATNCSGSCSAHIIVNVLDKPGPVRDLKISDISVDRC
KLIWDPPEDDGGCEIQNYILEKCETRRMVWSVHSAAVISNSANVTRLVEGQEYIFRIRAE
NKMGTGPAVESQAVIARTQFNRPGPPDPPEVTKIGKEEMTVSWRPPGKDGGKPVTGYILE
RKELHSIKWVPVTKDPIPQTCMNVTNLIPNHEYQFRVKAQNEVGLGDPSKPSISVTARDP
VGPPGPPEDLKVADSTQTSITLCWQRPVCDGGAPIIGYVVEFRIKGASKSADEGWKRCNV
AARLAVTDFTVTSLDEKLEYEFRVYSQNQVGMSQPANLKDAVSPKEILEAPDIELDANLR
KGLTVRAGCPIRLCATVRGRPAPKVTWRRMGIDNVVRKGQVDLIDTMAFLVIPESTRDDS
GKYSLTLTSPAGEKAVFVNVQVLDTPGPVQGLEANDITMVSCNLSWSPPENDGGSEITHY
IVEKREIDRKTWATVNNDVKKTNLKITNLISGTEYYFRVTAVNEYGAGVPKISPKSYLAS
NPISKPDPPLKIDVLEITKNSTTLAWVKPLRDGGAKIDGYVVDYMLVIPPQEIKDGQLVV
QEQIKPEEQWMPYSIVKDLSIAVVGLKENMKYKFRVSARNVMGCSLPTETKGEVEIKEQM
LPPKIIMVDTVTAKAGEKLRVEALVSGKPTPVCKWNRNEEEVIPSSRLTVHKSQNSCVLI
IKDVSRLDSGQYSLSAENSIGQVEQSLKIIIKDIPGPPEPPFLISDINADTCTLSWQSPL
EDGGSTITNYVVEKCDMSRNDWVIAVSSCTKTTCTVGKLIPGKEYIFRVRAENRFGLGEP
IVSERMIAKFPFDLPSEPLNCHILKVNKDCMFVAWEKPANDGGSPITGYYIERKERNSLL
WVKANDTVVRTTEYPCSGLIEGLEYTFRVSAINRAGQGKPSKNTEFATARTPVDPPSKPE
VLDVTKNSVTLLWNRPKHDGGSKIIGYYIEALKIPEDKWVRYNIISQNLPKEEYTVTGLE
EGRKYQFRILAKTAVNISRPSEMSDPVLISSENVAPTIEIGLQMKALQPVKAGKNVCLEA
QVFGKPMPKITWKRNGEILKPSEVLKMSQKRNLFFLELLSVTRNETGEYTILAENASGSK
SGEIKLTVLDVPGPPVSVKFGDVYADHIRLSWEPPITDGGSAVTNYIVDKRETSRANWAQ
VTSKISAQQTDYSVEKLIEGHEYQFRIHAENKYGVGDPTLTNPIVAKNPFDVPGACDPPI
ITNITKDHMTVSWKEPASDGGSTILGYMVEKQETKDVKWDKVNRKPITERSIEATGLSEG
NEYKFRVIALNKAGLGKPSDPSKAAIAQDPLYPPGPPISPKVVDTTNCTVSLCWTEPANN
GGCEILGYLVESKRADAADWTRCNVPRNLQETNYIVTGLTENTEYMFRVTAVNKVGFGEP
SEVPGKYTAKDILVPPEAELDEELKKTVELRAGTPMRLYILLRGRPVPKATWAKMNTNIK
DRPGIVIKTTQFDTLVYIEKVNRYDAGKYILNLENSSGVKMYTITVKVFDTPGPPLNLMV
KETSKNSASLLWDAPLIDGGSPVKNYIIEKRDAERKSWSTVAYDCTKTSFLIQDLEPGRS
YFFRVLAENEYGVGEPCEITDAVRASEQPGPVLDFKALLVTKNSCTLAWKKPISDGGSRI
IAYVLEVKNGKDTWKNLMKSKNMQYSAKDLIEGKEYTYRVRAVNDAGDGVAEELNVLAKD
HTVLPGCDLRDLPNLCYTAKEGSTVRLKIPISGKPAPTVTWKKGEDVTLTDSGRVSVEST
AVHTTLLIHDCQRGDASKYTITLRNSAGTKESAIFLKVVGKPGIPTGPIKFDEITAEGIS
LKWGTPKDDGGSEITNYILEKRDSVTNMWVTCSSTVQTNSLRVTGLHEGTEYTFRVSAEN
KYGIGESLKSDSVVAKHPFNVPDAPPPPQIMSVHYDSAQLAWSDPRKTGGSPVTGYHVEY
KERNSLLWKRANSAPVKMKEYKVTDLTEGLEYQFRIMAINLAGVGKPSLPSEPVVALDQI
DPPGKPDVVSITHNSVTLQWTEPKYDGGHKLTGYIIEKRDLPSKVWMKANSTNVLDCAFT
ITGLQEGCKFEFRVRAKNAAGAISPPSEQTDTIVCKDEYEAPNIIIDPTVKEGLTLRAGD
TIVITATSITGKPPPTSRWSKAGRDLKPSDLCQIESTPTSSTLSKKCATGKDSGEYTISA
SNPFGVREENVKVTVLDVPGPPGPLIASNVSAEKVTLTWSPPHDDGGSAIKSYTLEKRET
SRLLWTILAENVTDCHLVTSKLIQGNEYIFRVSALNHYGVGESTQSEPVKMEDSFGPPGP
PSKPDIENVNKNSVTISWKRPVEDGGSNIFGYNVERKERDGMRWIRASKKLISDLNFEVV
GLTEGNEYEFRVTAENKAGFGEPSEPSQPVMTKSLAYVPGPPSNPRITDITKSTATFNWG
RPKYDGGLDITGYIVEHKREDENSWIKDTTGSALRISEFVISNLQQGEKYNFRVSAMNEM
GIGEPAQVAESVEIVERQETPDFELDAELRRTLVVRAGGSIRIFVPIKGRPTPEVTWLKE
DISLKGHANIDTTESYTLLVISHCTKHDTGKYNLTLESVAGKKSGYVNVRVLDSPGPPIN
LRPREITNEGVTLQWEMPLIDGGSKIINYIIEKREATRKSYAAVITNCQKCSVRVPNLAE
GSEYFFRVRAENEFGIGEPAETSDAIRVSQAPTAPEKVNIVAITRNSASLIWTKPKHDGG
SRITGYVIEAQKKGSENWSHVTTAKTLDYTVKNLNENDEYIFQVMAVNNSGRSDPCQSSP
VIIKEQTKGPQFDLRGICQKLVIAKAGDDIKIEIPVLGCPQPTISWMKEDKALNQTQRVY
IENTPMSTLLCISECTRNDSGQYAVTGKNILGTLTEIITVKVHDIPGPPKGPIHYDRISN
ESITISWDPPENDGGVPINNYIVEFRDTTSTSWSVLSTTIIRTVFKAERLTPRAEYQFRV
KAKNRYGVGPPITSESVVAAYPFKVPGPPGTPQVIGFTKDTMTISWNEPVNDGGSEVIGY
HIERKERNSILWQKVSSALIVGNIFKSIGLEAGIAYEFRVAAENIAGVGKPSKPSEPSLA
LDPVDPPGTPVAINISKNFVNIKWTKPNYDGGFKITGYTVEKKDLPNGRWIKVNYSNIQE
TTFTVSGLTEGASYEFRVLARNSAGAVSSPSEPSDPIVCKDDVEEPKIRVDARFKDVLLV
KAGEVFKLEADITGHPLPSMIWTMDGKEIEKTTKLEIKMADFSTILINKDSTRRDGGAFT
LTASNTGGFAKHVFNVKVLDRPGPPDGPLLVTCITAENCVLSWLPPSNDGGANIEYYIIE
KRETSRLAWTNVASDLQVNQFKVTKLLKGNEYIFRVMAVNKYGIGEPLESEQIIATNPYM
PSDPPQNPEVRNITKDSMVIYWEEPVNNGGAEISGYIVERRDKTSLHWIRCNKKVITDLR
YKVSGLTPGHEYEFRITAENAAGLSLPSASTPFCKASDPLYKPGPPGNPRVLDTTNSSIT
VAWNKPVYDGGSDITGYIVETCLPQDDEWTDVTPKDGIVTTLFTITNLKGNQEYKINIFA
VNCEGVGEPASVPGLPKTEERQIPPDIELDAELRKVVTIRACGTLRLFVPIKGRPAPEVK
WSRENGESIERATIESTSSFTWLLIENVNRFDSGKYVLSVENSSGLKTAFVNVRVLDTPG
APQNIKIDEITKESVSLSWDPPILDGGSTIKNYIVEKRESTRKAYATVNANCHKTRSTVN
NLLEGCNYYFRVLAENEYGVGLPIETRESVKVSEKPLPPGKITLQDVTKNSVTLSWEKPE
HDGGSRIIAYVVEMQSKGSDTWNQCMIVKVTEAIITGLTQGEEYMFRVSARNEKGTSDPR
QIGVPVIVKELVITPAVKLLFSTFSALAGEDLKIEISYVSRPKAAMSWYKDGVPVKQTSR
INFEMADTHLYLNIKEVCRGDVGRYTVKLSNTVGETTAEICVVVLDKPGPPAGPVNVAEV
TANSITLSWKPPEYDGGCTIKNYIVEKRDASTTDWQVVATNLPRTTIKAGRLKTGSEYQF
RITAENRYGKSPVLVSDTVVAKYPFKVPGPPGTPYVRAATKDNMDVIWNEPVIDGGSQIL
GYHIERKERNSILWIKLNKTLIRDTQFKSVGLEEGIEYEYRVYAENIVGIGKVSKLSECY
VARDPCDPPGTPEVVTVTKKSVFLRWAKPEYDGGSKVAGYIVEKKELPEGRWARTNFTNV
TETEYVATGLTENQQYEFRIIARNAAGIFSSPSLSTGPITAKDEVEPPRISIDPRYTQTI
IINSGENFKIDADIFGKPMPTISWMKGKQILSNTKHCKIKSTQYSTCLSVKEATSNDSGQ
YRLLLKNIGGEKSVLVTIKVLDRPSPPEGPISVSNLTKEQCLISWKPPKEDGGDEISHYI
IEKRETSRLVWTVVEPETKELNLKITKLLEGNEYIFRVSAANKYGVSEPLESEAIIAKNL
FVSPDAPKGVEVVSITKDSMVVIWSAPDNDGGSSITGYVIEKHDKEGIRWTKCNKHTVTE
LSFKVKGLFEGHNYEFRVSAENDAGVGKSSSPSIYYMAIDPVFRPGPPNSPKVTNISRTS
VFLSWEKPIYDGGCDIQGYIIEACEATSEEWKMCTLPTGIKQTQYEVEKLKENQNYKFRV
FAINKVGVGEHTDFPGTILVEDKTQEPDLDIEMELRKTINIKAGDSLRVFIPIRGRPAPE
IRWEKVDGKIKDTAQIEMTSSCTSLVIDNVNRFDSGKYTVTAENVCGVKTATISVKVLDT
PSAPLNLKVKEITKESVTLMWEPPALDGGAKIKNYIIEKRESTRKAYAAVVTNCHRTTWK
IEPLQEGCNYYFRVHAENEYGIGLPAETVDSVKVSEVPQVPKKFTVVDVTCKSVSLAWEK
PDHDGGSKIVQYLVEMQVKGNEKWSGCATVKTLDTVVSNLVQGEEYMFRVIAINEKGKSD
PTSLAVPVQAKDLVIDPDVRPAYSNYSVLIGKDLKVEIPIFGRPKPKIIWTKAGLALKET
TRVNVINTAHHTTLNIKETTKDDGGIYGITVSNVVGQKDATILIITLDKPDPPAGPVRFD
EISSQSVTISWDPPKYVGGCHISNYIVKKRDITTTDWENVSTTVPRTTLKVTRLKTGAEY
QFRIIAENRYGKSHALDSASVTVQYPFKVPGPPGTPFVSSLSRNHMIVEWHEPITDGGTS
IIGYHLERKERNSILWTKINKTLIQDTYFKTSPLDEGVEYEFRVFAENVVGIGRCSKISE
GYVACDPCDPPGTPEPIIVNKNAITIQWAKPEYDGGSIITGYIVEKRDLPDGRWMKANFT
NVTETQFTVSGLTEDSKYDFRVIAKNAAGTISKPSYNTGPITARDEVEPPRLSLDPEYSQ
AVVVSAGSTFKLDADVYGKPTPTVQWFKEDKGIENTLRCEIKRTDLRTILTVKDAIKTDS
GHYNLQVANVAGTKIFTFYVKVLDSPGPCGGMLNVSAVTSETCTLSWLPPEHDGNSNISH
YIIERRETSRLAWTVVASKCDVTSFKVNNLLEGNEYIFRVMAVNSYGVGEPLESSPVTIK
NPFLLPGSPQSVEVTNIAKDSMTVFWSSPESDGGSEITGYIIEKKDKTGIRWTKCNRQTI
TDLSFRVTGLTEDHEYEFRISAENMAGLGEPSLPTSYYKACNPKFKPGPPTHVHVTDTTK
NSVSLAWGKPIYDGGCVIQGYIVEICKADEEEWIMCTPATGLPFNKLDITKLTENKEYKI
QVCAINKLGIGEPAAIPGTVKVQDKIEPPGLTIDSELRKGIIVRAGESIKINIPFRGRPT
PKINWTKDEKELTDKVHIEKRLDYTQLSIDKCDRNDTGKYTLTLENSSGIISELVSVKVL
DTPGAPMNLAVKDIKKDSVVLEWEPPLIDGGAKIKHFIVEKRESTRRVYVNVTAKCDKTF
CKVDNLTEGAMYYFRVMAENENGISHPVETKNPVKVSEAPLSVGKVILTNVTKVSASLAW
EKPEHDGGSRIIGYLIEMQPKGSDKWSVAASTKTCEGTVEGLVFSQEYFFRVLAYNEKGK
SIPVLLAAPVIAKDLSTEPMLKLMFNTYSIRSGDDLAIELHIIGCPKPKIMWMKDGQSLK
QTSRVSVLNTPNTTTLKIKEANKDDLGKYTVTATNDAGIATEEIGIIILDKPGPPTGPIN
INDVSNNSVTISWEPPVYTGGCQIKNYIVEKRDATTTVWQVVSANVSRTTMKITKLATGS
EFQFRVSAENRYGKGSSLDSKAIVVQYPYKPPGPPGTPFVTSVTKDDMVVQWNEPVNDGG
SRVTGYHLECKERNSILWTKLNKILIVDTIFKVNNLEKGGGYEYRVFAENIVGIGRSSKV
SECFVALDPCDPPGTPEPIFISKNQVTLQWTKPQYDGGSKVTGYAVEKKDLPEGRWMKAS
FTNIIETEFSMTGLTENEKYEFRIIAKNAAGNFSEPSDSSGPITITDEIESPRASMDPKY
MDIIFINAGETLVIEADIYGKPAPEVLWKKDGNKIDKTTRRNDIKHAIKNTSLTVKDCIR
EDSGNYTLTLSNAGGIKTIPITVKILDRPGPPEGVLKVTDVTADSCLLSWNDPLQDGGAS
VIHYIIEKRDTSRLSWTIAESDIQAFSYKVTNLLAGNEYVFRIKAVNKYGVGDPLESEPV
TACNPFKPPSAPSIPEATAITKDSMVIKWNQPENNGGSEIYGYHLEKRDKDGVRWTKCNR
SKLSDLHFKVNGLTEGHFYEFRVSAENEAGVGQLSEPSMFYRACNAACPPGPPTHPKVTD
HTSTTVSLAWSKPDDDGGAYIKGYLVEMKEATQGEWTICTPSTGIQATKFTVGKLKENDE
YNFRICAFNAEGVGEHADIHGCVAAVEKHEAPEIELDADLRKVVSIHASGTLRLFVTIRG
RPEPKVKWERAEGLLTERAQIETTSSYTMLVIDNVNRFDSGRYILSLENKSGTKSAFVNV
RVLDSPSEPLKFEMKDIMRNSVTISWEPPLSDGGAKITNYIVEKRESSRMAYTTVTSNCT
RNSFKVDELQEGCLYYFRVLAVNEHGVGLAAETKDPVKIAEVPMPPSKVSLFDVTRNSVI
LSWKKPDHDGGSKILCYNVEMQTKGSEKWTVSTTVKVLEATITGLVSGEEYSFRVIALNE
KGKSNPKELGVPVIAKDMETEPTIDLIFNTYSVKAGKDLAIEIPFKGRPKPIVSWKKDGL
PLKQTTSLTILTSVTSAKLLFKEATREHVGKYDLTVANAAGTKTAEIAVFVLDKPGPPAA
IRIDDVSAESISLSWDPPAYDGGCHISNYIVEKRDTNTNEWQIVSSTVARTSIKISQLIN
GSEYQFRVYAVNRYGRSHSIDSSSITAQYPFRQPGPPSTPQVALASKTFMLVKWNEPVND
GGSGVLGYHIEVKERSSILWTKLNRSLIRDTEFRVTSIEEGLFYEYRLYAENIAGIGKCS
KVSEPVAARDPCDPPGQPTVTNITRTSVSLSWTKPEYDGGAKVTGYIIERKEEERWLRCN
FTNVQETYFVVTGLTENQKYDFRVIAKNAAGLFSEPSNCTGPVMIKDDVEPPRIMIDAKF
KDVVAVKAGEILKITADFSGRPLPVISWTKDGKEIEVRAKVNIVSTDTCTSVIIKDCIRS
DSGQYVLTLQNVAGIKSFPVKCKVLDRPGPSAGPLDVTDVTAEKCILAWGPPQEKGGAEI
SHYIVEKRETSHLAWTLVHGDLKATTCRVTNLQKGNEYIFRVLGVNKFGIGEALESDPIK
PTDPFSTPSPPTHVKITDVSSEAMTICWEKPVTDGGSVVCNYVIEKREKSGLHWVRVNKE
CVCDLTFQTTKLHKGCQYEFRVYAENAAGLSLPSDPSPLTNAEDPQCVPSPPSKPKVIDS
TKNSITIIWNKPLMDGGSPVTGYNVEYKKTEEEDWIVAAENTKNTEYTVAGLTSGAEYVF
VVKSVNKIGVSDPSAHSVPQVAKERVEEPTFQVDKEMHRTLVVKHNTSFTLKVQFKGKPV
PSVMWQKEDVNLKDSATIYTNDNSTSITVEKATRNDSGKYTVTLDNSIGTAALTLDVKVL
DSPGPPSKLSIKEVTKDSLILTWDAPDNDGGDPVKNYHVEKHEASKKAWVSVTNNCHHLT
YEVKNLQEGAFYYFRVTGENEFGVGVPCETKDGIKVTEKPSTPTKFGVTDVTKDSVSLAW
NKPEHDGGSRITTYLIDALEKGQKKWVKCAVVKTTHYVVQGLKENAEYFFRVRAENYAGL
SEPKELITPVIVKDKLESPEFDLKNFPHNTVYVRAGSNLTFEIPLTGKPLPKLTISKDNA
AMKVTKRFNFEVTFENVIVNLKESIANDAGRYDIIASNKGGITKTFVNILVLDRPGTPVG
PVEIIDVSEDSVSLQWLPPVYNGGSPVTNYVILKRETSTSAWTEVSSTAARSAIHITKLT
KGEEYQFRIKAENRFGISDHIDSKAVTVKLPYKIPGPPSTPWVTMVSRESLTVCWHEPVS
DGGNPVFGYHLHMKERSSTVWQKVNKTPIHATQFRVTNICPGLIYEFKVAAENAAGIGKI
SKTSEEVLAIDACEPPANVRISDITKSSVTLVWQKPPYDGGSKITGYIVERRDAPKGRWT
KANFTNVTETNFTISGLSTEEFYEFRVFAKNSLGSISNPSLTAGPVKCVDAHGAPEIDLP
PEYLDVIKFMAGNIVKIQVGIISKPLPVIEWYKDGKELVSSAQLSIENTTDASGIVIKDA
NRLDSGTYEIKIKNVAGSTSASIRVQILDKPGPPGRTIQFKTITADKITFTWDPPVDEGG
AKVTHYVVEKRETSRVAWSVISEELEECYISVEKLIRSNEYIFRVRGVNKYGIGDPLESE
PVVAKDAFVAPGQPAMPYVASITRSSMTVVWEKPSVDGGSEVIGYCLEKRDKKCLRWQKV
FKDPICAVTQKVQDLIEGKEYQYRVCAMNQAGEGPYSDVSDFYRAADPIDPPDEPTKIKV
LDSTKTSITLGWGKPQYNGGSEITSYVIEKRLAEENEWVIISSKGEVRTTEYVVSHLKPG
IDYFFRVTAVNCAGRGKPLEMIEPVQAEDILAEAEVDVDVTMRTQYTVKAGTDVEIMVPL
KGRPAPSITWKIGDKDISCDPRYDIRNSESSTVVFIRQVTRNDTNKYRLEFENGVGTPKT
VTISVKVLATPSACQKLTVKKVTRGKVTLSWEAPLLDGGAPVANYIIEKRDSTKRSYSSV
TTKCSSTTYDIEDLSEKSLYFFRVSAENEHGVGDLCETTEPVRATETPGPVKDILMKDST
KASVALQWSKPDHDGGSIISDYVIEKRLKDEEEWAFAGTSKICEYEVKNLKELAVMEFRV
CSKNEKGQSDFTEFGPITVKEFIIPPEADLSGYPKGEIHVRIGHNVHIELPYKGKPRPGM
EWLKDNLPLKESQQVRFKRTADKITLMIKNLTKHNAGKYTLALDNKVFRKLFHIKVITLG
PPSKPTGPIRLDEIRAESIIISWDEPNDDGGGEITSYTVEKCDISQTDWKMACSNVTGTT
FKIPNLIAGVAYQFRVCAENRYGVSEPLFSQNVIAKHQYRPPGAPGKPVIYNVTNDGMNI
RWDAPVFDGGSPIMGFHIEKKEKNSIMWQKVNLTIIKERDYRIIGLIEGLEYQFRVSAQN
DCGISRVSEASKLTMAASPVDPPGTPDYSDVTSESVTLKWDAPKHDGGSKIVAYSVEKRQ
GKDRWLKCNFIDVAECQFTVTGLTCGERYEFRVFARNAIGTTSPPSQSSGYIVVRDESVA
PNIDFGKEYFEGLTVKAGDNIRLKVNVTGRPKPHVKWFKDGKEIDRRMMIDITTTNGSSM
LFIRDADRNHCGIYSVEAKNASGSKKEDIHVQVLDSPGEPAGAIVFTNISEDSVTLSWNP
PKNDGCSAITNYIIEKRETSKVSWTLVADHCENCSYTVSKLIKGNEYQFRVSAVNKFGAG
RSLESDPITIQMQFAIPEAPGTPDPTSITGDSIMLTWTIPKYDGGNEIKNYFLEIREKKK
MHWMKVLSKIPITEPLHKVTNLTKGSEYQFRVSAVNDAGIGSPSNTSEFIRCSKPISTPS
APTVINVTDSSKTSVRLEWTKPLSDGGMEISGYIIEMCKVSSGDWHKINAENCTNTKYTA
TDLEPDEEYNFRVCAVNGAGRGETREILKPTKALDRLASPEIDIDASFKQTHIVKKGTTI
HLHVGFKGNPAPVTTWKKELGEFSVMAGINTTENFSTLTIDNCNKYDSGKYSLSLENSSG
SKSITFTVKVLDTPGPPGSITLKDVTRGALTLMWDAPINDGGSRVLHYIVEKREASRRTW
QQVSSKCVLQHLRVNDLLEGVPYFFKVFAENQYGSGEVYEMPDPVIATAEPAPPKRLDIT
DTTDSSATLTWLKPEHDGGSRITGYIVETKIKGSDKWVIGGHAKSLTMVVDGLTENAEYE
FRVKAKNDAGISDAREAFSSVIIKEPCIEPTADLSGITNQLITCKTGGTFTIDVPISGRP
TPNVIWKLEEMRLKKTDRVSIKTVKNRTTLSVKDCMRGDGGKYYLTLENIAGTKTFTITV
NVIGRPSAPCRPIEVSSITSESCVLSWEEPEDDGGSDITNYIVEKRESGSSAWQLVNSSV
KYRTIKITHLVKYMEYTFRISTENRFGVSKPTESETIVAENPFVPPSAPTRPEVFSVTAN
CISIRWEEPYHDGGSKVTGYWIERKERNTILWVRDNKVPCFECCYKVNNLVEGLEYQFRV
YAMNASGLSKASEASRRMVAQNPVDPPGKPEVTDLTKSTVSIKWSVPLNDGGREIVGYIV
ERKPYSATGDGRWLKCNYTNITDTSFTITALGEGEVYEFRVIAKNADGVYSLPSESTGPV
TCKAEYQPPVAELDSKLLTDTVTIRAGSDLVLDAAIGGKPEPKVFWAKGDKELELCEKYT
LQYTKSRAMAIIKFCDRNDSGKYILTVKNASGVKTAAVNVKVLDTPGPCKKITITGVTER
KCTVSWEIPMEDGGDPISHYIVERRDTNRLNWVIVEAECKALSCIITNMIKNLEYVFRVR
GVNKYGPGVPLQSESIVARNLFTIPSPPGVPEIINVGKDFAIIQWSKPESDGGSEISNYL
VEKRERKSVRWIKVNKDLTITDTSFKIYGLLEGNIYQFRVTAVNAAGESEPSAVSLYASC
REPTYTPAPPSIPRVVDTTTDSISLVWTRPVQDGGADVIGYILEVREDGREQWSKVHEKL
IRISEYTATGLTYKTKYSFRVAAVNVNGVGEFSDACTASEPLERTEIPDLEIDDELKKTI
CLRAGGSLRLFVTVTGRPVPEVKWSKPGVDLQSRGFIEVTDTHTTMTINKVNRYDAGQYT
VEAENPSGKKTATILVKIYDTPGPPGPLNIKDITDSSAVITWDAPSVDGGAPVNNYIVER
REASMRAYKTVTSKCHKTSYKVTGLPEGMLYYFRVFPENIYGIGEPRESSDVVLVCEVPM
VPQKLEVMDVTKSTVTLAWDKPLHDGGSRLTGYVIEACRFGTEKWMKVATLKTTDFQHTV
VSLNENDQYLFRVRAINCRGVSEPRETVTAVTVQEQKVLPKIDLSGIPQKIVNVLSGKSV
ELHVPIAGSPAPVCSWYFGDVKMRVRDRVKIVTTKTYSELTVCDATIDDTGDYTLEVKNA
VGAVTEIIKVIILAKPDEPRGPIRIVECDTTSITISWDPPERDGGAPVCGYVVEQRDAHR
PGWLPVSQSVSRTTFKLNRLTEGNEYVFRVAATNRFGTGSFLQSDIVICKSNKTIPGPPG
RPEVFDVSRDGMTIAWHPPEEDGGFEISGYIVERKEVRSDRWIRANKNPVTKTRYRSSGL
IEGLEYEHRVTAINSKGTGKPSFVSKTAVASDPIDPPDSPQNPRVTDTTTTSVSLAWSPP
DDEGGSKVAGYLIEMQKVGTFQWIKCNTTPSLICEYTLTQMPQGAEFKFRVSACNAGGSG
EPAEIPGTVKITEMLESPDHDLEAKYKDGFVVRRGGVIRLSIPIRGKPIPTCMWTKEGHD
ISRRAMIASSEDLTELVIKEAQRNDTGVYNLVLQNKCGKKFVSINVKVIGPPDPPQGPLQ
INDIQACSVRLTWKAPIDDGGSDIHSYIVERREIPNLAWYTVDSKVVDTSLVVKGLQENV
EYHFKVTAVNKFGISKSLKSEESVTPKTPLCPPDPPSNPPEILDVTDNSVSLLWGRPKND
GGSCVTAYYVERRERFNENWVRHDAHVTANTYKLTGLIAEKEYQFRVIAKNDIGESLPGP
ISELVLCKDPFDKPGQPGETDTVNVTKDCISIRWEPPRYDGGKQILGYWVEYRKSGESTW
KKCNKERLKDTVFTMTCLLEATEYEFRVFAENEAGISRPRRTTVGIKTKLSVVHKPSIIK
EMEDATTKLGQPGTLKCQITGRPLPVIKWYRHGKELLQGKKYEMNSDGRNHSLTITSNQQ
DDEGVYTCKAINEAGETETSGSLIFEAAPMLSPEYPLKEIYHIVCGASLRLHVMYIGRPE
PKITWLHNNVPLQPTENVIIENTKHYTHLIIKNAQRETNTGKYKVQLSNTFGTAEKLLHV
EIQDKPGTPEGPIIVEALLKNSVIISWKPPADDGGAMITNYIVEKCEDTSSEEWNLVSSS
VSGTSCRIPNLNEGAGYYFRVSAQNQYGVSDPLQIPSVVIIKSQLEKPGNPQNLVVSGVT
KDSCIVSWIPPLNDGGSKIKNYCLEKCEKENEWISVTTDEIHQTVYTVNGLVENSEYKFR
VKCDSLWGESDYSEVSARVVPKSDVAIHTPAFKEELRNMSVKYKSNATFVCKISGQPKPV
VKWYKRGKEIQPDGQKIKVQERKGGYYQLVISAADEEDSTVYQVRATNQGGSISANVSLD
VEIPAKIHLPKHIQNKESIPALRGEVISIKIPFSGKPDPVITWQKGQDLIDSNGNYQVIV
TRSFTSLIFPNGVERKDAGFYVVCAKNRFGIDQQTVELYVADVPDPPRGLKVSDVSRDSV
TLNWCAPANDGGSKVTNYIVEKCATTAERWIRVAQARDTHYTVVNLFGKTSYQFRVISEN
KFGQSEPSEPTDPVVTKEDKSRALSYDEEVDDTGEVIKRKALHSETEVLHNKYMIAEELG
RGHFSIVHRCVENSTQKTFMAKFVKVKGADQALVKKEIATLNVAQHKNFLCLHESFESPE
ELVMIHDFTSGMDIFERIGAANFELSEREIVTYVRQLCEALEFLHSKSYGHFDIKPENIV
YTKSSSSNIKIIEMGQAQYLTPGETIRIQFTAPEYCAPEIHRNEMVSTVTDMWSVGVLVY
ILLSGLNPFIADTYQQTIENISNAEYIFDEETLKISSLEALDFVDRLLTKERKHRMTASE
ALEHPWLRKNIEEYNSKAIKTTRHKRYYQTLVKKEWNVVISAARVARGGALRSQRGVTVS
KVKVAPYEHGPRAGQIKHSVSEEGGHAKFVCHIENYDSSTEVTWYCGVRQIEESEKYKIS
YDEGVTILSIENISRADDGTYRCKVINEYGEDSAYAELFVKNVRSYSDFFFARTVKKAKR
RVDTERLLQRPPEFTLPLYNRAAYVGEDVRFAVTITVHPEPRVTWLKSGQKILPGDNDRK
YTFINDKGLYQLIIHNVQTEDDGEYTVLARNKFGDDSCKARLTVSPRPAPSDNTLRPMFK
RLLANAECKEGQSIRFEMRVSGSPSLKWEKDGMQLAFGPQVEVIHEGLDYYVLHVRDTLP
EDSGTYRVIATNSAGSASCQAALKVHRLTHVKKEYDTEEQKKTCPEEKKIEKKVRLLQIL
SGSEVIPLTPVAQEALREALIMHKPEISTKKDRIEAVDKKEKEEGKMRAEDKRLHMPYEI
PQPRVHAPTTLEEDLEIKHFVPYSDMKWYKKIRDQYDMPERMEKPVQKRLKRISLSKWEQ
NYVVPLPRIKDQYKPKWRIPKFSQDDLETVRPGRYRASSPESEVYYRQRRRSLCDLTDEE
FLLPVQDYLSMKKTEEERLRFEEELQLGFSGSTFSSVDFELSSLRQFPSKKMTSEEKKVE
DVETYDSYHIPSKYETGPSYIDLRQRHDKVTYRPPRQNQRVLEDKEDQELLRPIASMQRH
CAYKSEMKRMQFDEKIQLSRKEKSKVHVSPLIEEKMEKNEYPSALLPSPFTQVISRSLLP
SHGELVHPLSGNVQSGSTLQAREEESETIERISKISERTRTSSPILGELLLPEKHTTTDI
MATYAAKKAALKSERKYEVVTQQPFSLDHAPRITVRMHSHRVPCGQKTKFTLNVQAKPES
EIKWYHNGKQIQESSKFCFTNISGVLSLEVLDCQQEDSGTYRVVCTNYKGEASDYGTLDV
SRGEYSAYSSHYKDEESLPAVVPEITKTDFYHLSSVKPVSASETLIVLKETKLELSEMHP
VSSCEEYASTEKKTTALEKITPQEKVKTILPARILKKPQSLMVQEGQFVEFICDVDGDPS
PSVTWRRAGQEIVSSNRYHIITSQYKSAFEIMKVQLSDEGNYTVVVENSDGHEEVEFTLT
ICMSTDEEKIAVSPSKSPVSASTKEHVESSADTKTRTKSSESEMKPLDISDASSPDSYKS
PEESSVVKTPPEPSLSPVKVQFPPEEESQEVQKPPKIVNQLNAKASEDKIIMYCVVEGST
DTVIWYKDGINLTQDRHYYFHTSTDGLCSMNISDITESDQGEYTCEIISEGGVSKTSFSF
VGQVFQNILKKISTFLEENKCLDEKETDISITKPTSGSLAANKESQIETQKEAPSESHIL
KKVTEQIKPEIFHEEVQSHTEIKVTHSQVTAFEGQSLILKAEIPGVFCVKWLLNGNELVN
SEDYTYGMSENDQTLTIKNISQHEEGTITCEAKTESGIVKCHFHTTLSAKPEGRPSFCIL
PKSQNVKEGQNVIFTCELHEGSPVEIEWLKDNVEVLWTSNLKESHSKNIYTLEIKEASTG
DSGKYTIKAKNIHGQCSATASLNVLALTEEPDKSVLLEKDELAASMLGRFSAKEVHMAAS
MQETSFRSTSLTEMKFASASAYSTQSLTAEIALSSSSIMEMSSHLQIEGSSKGAITQGLP
PKIKTLPEEICIEKGKILTVACVFSGEPLPEIEWTHSGITLPSTEESDRLNIETTEDLTT
LIITSVKENDAGSYTLKLSNEFGSDTATVNVIIC
NT seq 92805 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcaggcaccaacattcatacagcctctgcaaagcgttgtggcacttgagggt
ggtgctgcaacgtttgaggctctaattagtggtgttccggttcctgaggtgagctggttt
cgtgatggccaggtgctttctgctgccactctgcccggcgcacagatctcgttcagcgat
ggccgcgctgttctgatgatccccgccgtgacagcggcacacagtggaaggttctctgta
cgagccaccaatggtgccggacaagccactagcaccgcagaactacttgttacagtggaa
actgcacctccaaacttcattcagagactacagagtatgactgtgagacaaggaagccga
gtaagattggatgtacgcgttacaggaatccctacacctgtggtgaagttctatagggag
ggagctgagattcagagctctgctgactttcaaattgttcaagaaggagaccgttacagt
ttgttaattgctgaggcctttcctgaggattctggaacatactccgtcaatgctaccaat
agtagtgggcgtgctacttctactgctgaactgctggttcaaggtgaagaggaagcaatt
cctgccaagaagtcaaagactgttatttccactgctcaaatatctcagactcgacagaca
cgagtagagaagagagcgaaagcttattatcaggctacagccaccactatgatggaagtc
catgtggatgaaggtgatactgctcagcagctgctacacaaggctcccccatctgtggcc
ccaaagccaacttcaaagtccccaacatcctcactagtgtcaaaagttgcaggcgcacgt
caacagtcaccttctcctgtgaggcatattaaaggacctactccacctcctgtaaggtca
gtgtctccctctacaaggctgtcagtctcccctatcagaccagtcaaatctccgttgatg
acccgcaagcagattacgccaggctctgatgtcctccctccctggaagcagggagattat
gtagctgaatccagctatactagcatgattgccagtgcctcacgtgtccagacctctacc
actcaagtgcaaatggagcagcggtgggaaggctatggggtacagcagcaagtaactggg
attgtagcgaaagaggctgaaggtggaaaaaaggcagaggcagtggccacagtccttgct
gcagttgacctagcacgcattcgaaagcctgcacaggcagaggagggccacgcagaagag
gagatcttagagcctgacttaaaacggcaggctctggacactcaagcttctaaaatgatc
accatgaccatgaaaaccgaagcgctacaaattcccagttcctctcaaattgcttccgat
gaacatagggttcaggtttcacagatccaaagaagtacagaaactacaacaactcatgtg
gacacctcgcttgcaccatctccaataccgcatttcactgtttctaaagttactgttcct
aaacctgaccatagctatgaggtttccatagcaggttctgctattgcttcactgcataaa
gaactatcttctacttctgctgctcaaaagatcatcaggcctgtgaagcctccttctcat
aagattgtggagatgaaagcaaagcaagagccaaccccatcaccttttaaagataccagt
gaaagatttcaaatgcattttggcactctctcacagacagagataggcacttcttttaca
gggggcatggagcagatacatgaacagtgggagaaacaggctgttgaggcttcaacaatc
accatacctgcacaggagaccgtggctcctcctacccttgtcattggtttgaaaaatgta
actgtcactgaaggagaatctgtgactttggagtgccagatatcaggtcacccgaccccg
acgattatgtggtttagagaagactataggattgagagctctgttgacttccaaatcact
tatgagactggatatgctcgtttggttatccgtgaagcttttgcagaggacagtggtcgt
tttacttgcacagctaccaatcaggctggaactgtcagcacctcctgctacctacttgtg
aaagtatcagaagaaattgatagcaaggatactttccctgctgctcatgtttctctaaat
ggaacggagaaaccctggccagttgaagcaaaagaagaaattttagagctgactaccagt
gcagaggctatggcaccattctttgtaaagaaaccaatcgtacagaagttattggaaggt
ggtagtgtggtttttgagtgtcagattggtggtagtcccaagcctcatatttactggaag
aaggctggagttccccttactactggatacagaaacaaagtggtctacaacaaggatagt
ggagagtgcaagcttgagatctccatggcattcgctgacgatgcaggagaatacactatc
tttgctaggaatcagttaggagaggcttcagcgtctactacattgcttgaggaagcggaa
tatgaaacgtacatgaagatgcaggaaattacattcaaaactgaaatgaccacaatggtg
caagaacccaaagtagcagatgtccctccagcgattattagtgaatatgaaaaagaagag
attcttatgcagaagaggatggcccaacagatgcaaacaatgaagacctttatgacagag
caggaattccaaatctctgcttatgaggaaagaattattcttgagatcgagttctacatt
gttagaattagttatcaggagttagtgaatgaagatggggaagagattattatgaatata
tctgaacatgaagccatagcaccaaccttctacaccccagtgaagagctaccgggttttg
gagggaatgggggctgctttccactgcagagtaggaggaaatccacttcctaagattgcc
tggtacaaagatggcatgcgcatcaagcatggtggccgatatcagatggaggttctgcag
gatgggagagctagtctccggattcctgttctattgccagaagatgaaggtgtctatact
gcccttgcgagtaacatgaagggaaattctgtcagctcaggcaagttatacgtggaccct
gcaaccacagctgtggctcagtcatattatcttcagccagatgcaatcagcagaatcagt
tctacttcccctcgctctttgagtcggtctcccggacgtttttctggccgctctcccaca
cgaagactagatgagacagatgagagcctgttggaaagactgtacagacctgtgtttctt
gtgaagcccttctccttgaagtgttctgaaggagagacagccagatttgatgtgaaagtt
gttggcagacccatgcctgagactttctggttccataatgggcaacaaatagtcaatgac
tacaaccataagatagcagtaaaggaagatggaactcagtcgttaattattgtcccagct
atgcctcatgactctggggagtggactgttgtagctcaaaacagagctggaaaaacatct
gtgtccatgactctgactgttgatgcaaaggaaaacttggtgaaacctacatttattgag
aagttaaaaaacattagtgttaaggaaggaactttggttgagttagctgtcagagctatt
ggaaatcctcttcctgacattgtctggttgaaaaacagtgacattatttccccacaaaag
catcctcatatcaggattgagggcactaagagagaagctcacttgaagatttcatcagct
actggtactgacagtgcctggtacacagctacagctatcaacaaagctggaagagacaca
actcgctgcagagtcaatatagagttagaatttcctgaaccagagccagagaggaagctc
atcatcccaaaaggaacatataaggcaaaggagattgcagctccagagttggagcccctg
catcttcgctatggtcaagaacagtgggaagaaggtgacctgtatgataaggagaaacag
cagaaaccacatttcaagaagaaagtcacatctgtcaggctaaagcgttttggtccagta
cattttgaatgcagactgacacctattggtgaccccacaatggtggttgaatggttgcat
gatggcaaacccttggaggctgccaacaggctgcgtatgatcaatgaatttggctattgc
agtcttgattatgaagttgcttactcacgagatagtggtgttgtcacctgcagggcaaca
aataagtttggagttgaccagacttctgctaccctaattgtgaaggatgagaaaggccta
gtggaagaaactcagttgccagagggtaggaaaggaatgcaaaggattgaggagatggag
cgcatggcacatgaaggtgccctagcaggtgtaacagcagaagaaatatttgagaaaact
aagcctgagattgtactgcttcctgagcctgtacgggtcctagaaggtgacacagccaga
ttccgctgccgagtgactggttaccccacaccaaaggtcaactggtacctaaatggacag
ctcatccgaaagagtaagaggttcaggcttcgttatgatggtatttattaccttgaaatt
actgattgtaaatcttatgattctggagaggtaaaagttatagcagaaaacccggaaagt
gtgactgagcattgtgtgaaatttgaaatacagcagagagaggattttaggtccatcctg
cggcgtgctcctgatctgaagaccccagaatctggtccttcgccagatcgtggtagagtg
tcttttgaagttcaaaaggtagacgcacctgctgacacaacccagccaaaagagataatt
aaactaaaaaaagctgaaagagttgttcatgagatatcttcagaagagtcagaggaactg
agaagtaaatttaaacgccggacagaagagggttactatgaagcaataactgctgtagag
ctcaagtctcgaaagaaagatgagtcctatgaggacatgctgaggaagaagaaagaggaa
cttctacattggatcaaagaaatctctgataaggagaaaaaaatggaagaagaaagaggc
aaagtgactattccaacaattaaaccagaaagaatagaactttcacccagcatggaagct
cctaagatcttggaacgaatccagagccagtctgttttcccaactgatgaagttcgtttc
cgtgtcagagtggtaggcaaacctgacccagaatgtcagtggttcaaaaatggcattctt
ctagagaagtcagaccgtattttctggtactggcctgaagataatttatgtgaattagta
atcagagacatctcaattgaagattctgctagcattatggtcaaagctgtcaatgttgct
ggagaagcttcaagtcacgcatttctgttggttcaagtcaagcaaatagtttcctttact
caagaacttgaagatgccaatgccaaagagaaggacaccatggtgacatttgagtgtgaa
accagtgagccttttgtgaaagttaaatggttgaagaacaatgtcgagattttttctgga
gacaagtacagaatgcactcagacagaaacgtacacttcctctctgtactgataattgaa
atgaaggacattgcagactacagttgttgtctcgtggatgacgaccatatcagaactact
gccagacttactgtggagggtgctccattggttatacttgcagaattggagaatattgaa
gttcctgagacctactctggagagtttgagtgtgaagtgtctcgtgaggatgctgagggt
acttggtactttgagggcagagagatctctccaagcagcaaatatataatctcctcccgc
cgtggacgtcactctctttttgtcaaggatgtcagaaaggaggaccaggggaaatacagc
tttcttgttggtgacctaaagacaactgcttccttgaagatgaaattacgcccagtgact
ctggtgcaaggtcttgcagacctgaccatttgtgaaggtgacatagcccaaatggaggtt
aagttctctcaggaaaatgttgaaggcaaatggatgcggaatggtcaagccatcttggcc
actgaccacatacatatggtgactgacaaactcacccacaggcttcttattgaagatgcc
caggggagcgatgctgggatgtactccttttttgttccagctcattacttaacaacttct
ggaaagctgacagttcagaccattagtattttgacgcctctgaaagatgtaacctcggtt
gagtccactaaagctgtgcttgaagctaaaatatcatctgctgatatcacttcagtgaag
tggtatcacaatgacaaactgatgatgcctagtgagagggttcagtttgtagctaagggg
tacaaacaacgtttggtcttcgacagaacctttgcctctgatgaaggatgctataagctt
gttgttggaaaagctgagtccagttgcaatatgacaattgaacgggttcacattataaag
catatggaagatcaaatatgccctgaaacccagaacgtcacttttgaggtggagttatct
caccctggtattgatccagtatggagcttcaaaaatcagcctctcatacttgatgccaaa
tacaggatggaggctaagggcaagcgttaccttctgactgtcataaacaccatgaaagac
gaggaggggcagtacacatttgcagctggtgaaatgacttctagcgcaaaacttacggtg
tcaggtggtgcaattaaacgacctctccaagatgtcactgtagcagagtcacagactgct
gagatggagtgtgaggtagcaaaccccagcattgagggaaaatggttaaaggatggcaaa
cttttacagttcagcaacaacatcaaaagcaaagattttggggctattaggaagattatc
atcgttatcagtaggcctcaggacattggggaatacacttaccaggtggcaaactccaag
acaacagcaaacttgaaagttgaagctgtgaaaattaagaagacattaaaaaaccagact
atcactgagacccaggatgcagttttcagtcttgaacttacactagaacatgtgaagggt
gctcagtggatcaagaatggtgtggagattacccccagtgataaatatgagatccaagta
gatggcatggtgcacacactcaagatcaagaactgcacagcacaagatgagtcggtttat
gcattcaagcttggaaagctgtcagcaaatgccagactaaatgtggaaacaataaagatt
atgaagaaaccaaaggatatgacatctgttcgcgatgctacagcgtcctttgagctaagt
ctgtcccatgacaacatcccagtgaaatggatgttcaacaatgctgagcttaagccaagt
gaaaactgtaagattctctctgagaggaaggctcacaagctgatcattcaaaatgcggac
acacacaacgctggagaatacactgctatagttggacatttacagtgcagtgcatcttta
tttgtagaatctttacaaattacaaaaacaatgaagaatgttgaggtacctgaaacccaa
gtggccacctttgaatgtgaaatctcacacttcaatgtgccatctacttggctgaaaaat
ggagttgagattgagatgagtgagaagttcaggattgtagtgcaggggaaactccaccag
ctcaaaataatgaacaccagcagagaagattctgcagaatataccttcatctgtggaaat
gacagggtttctgccactttgactgtcaatcctattttgatcacatcaatgctgaatgac
cttaatgctcaggagaaagacacaatcacttttgaagtaaatgtaaactatgagggaatt
tcttacaaatggctgaagaatgacgtagagattcgttctacagaaagatctcagattcgt
tcaaaacagctctctcactctctgaccatccgaaatgtacactttggagatggtggagaa
tataaatttgttgctggatctgcatcaacatcggctaatttatatgttgatgctcgtgtt
attcagtttacaaaattcatcaaagatattaaaacaactgaaaagaagaaagctgtattt
gaatgtgaagtctcagaacctaatgtacaagtaatttggatgaaagatggactggaactg
gacaaatctgaacgatacaagatttccagtgagaaatatgtgcatcgactgataattcaa
aatgtttggttatctgatgctggagagtattgtgtagttgctggttcaagcacttgcaaa
gctcaactcactgtggagggtcgtgatgtccggatcacagagccaatggagaaggaaatt
actatcgttgagaagcacaaagctgcatttgagtttgaagtcaatgaggatgatgttgaa
ggatgctggttgaggaatgggatcgagatcaagttttctgttgaagacaggttcaactat
gttgtaattagaaaagtccatcgtttgaccatctcagagacctgtcacagtgatgctgga
gagtatacatttattgctggcagaaacagaagtgtggttacactcaatgtcaacattcct
gaacctcctcaaataattcagcatatgcagcctctgtgtgttgaggctgggaagccggct
tgcttctctgtggtggtgacaggaattcctcggccaaaggtcttctggtacaagaactcc
caggttctgtctcctgggttcaagtgcaaatttttgcaagatggtaatgagtacaaactc
ctcctcattgaggccttcccagaagatgcagctgtctacaggtttgaggccaaaaatgag
tgtggagaggctaccagcactgctgatcttatcattgaagtccctgaagtgatttcccct
gatactggatctccactgtccctccctgttatcatttctccaatttgcaacaccactgtc
ggcgtaggagaaactgctcagtttcagtgccgtgtctctggtgaagatttacagatcatc
tggtactgcaaagacagggagataaaacaatctgacatcttcagaatgtctcagtttgat
gataagtgtcaattggagattactcgagttttccttgaggataagggagagtacacttgt
gtggcgaggaacccagctggaatggtatcgtgctctgccgtcttgtctgttgatgtcctg
aaaatgggagagcagatagaaccaaaaaccacacaagcagccacagctttctctagcttg
accttcacaaatgaagaaaaacaagaatccactggcaccagcccatatttaactgaaaaa
accgaaacacttgaactcaaaccagagtccagatttgatcctgtacaattagaaaataaa
aaagaaaagcctgtttttgttaccaggcttatgccaacaaatgttactgtcggagatacg
gctaagtttactgtcacagtgtctggttttccaaaacctacggttgaatggtttcacgat
ggtcagatgatcacatcttcttcagtctataaattagttcaagagaaagatgagttcact
ttaattatttctcaggtaaaggtggaacataaagggcagtactcttgtacagcaactaac
agttatggccactcaacttctagtacgttcctgcatgtacacattgaggagaggagaaaa
atactccaaaaaccacctcctcgttttattttacccattgcaagtcttcagtgcattgaa
ggaggtgaagctcaatttcagtataatgtgactggggaaccacttacagaagttaaatgg
tttaaaggcagccatcagattcaacctagtagtcattatacaattcagaaaaacccagat
ggttttggatacttacagctacatggccttcagatggaggacagtggcctttatacatgt
caagcatctaatccttttggggatgcctcctgcagtgcagaactgattgtttgccacaag
agccaaacttacaatgaagaacacagcgtttatcagacgcagaaaggttacaaaatatca
atgaccgaagaagccactgaatcccgtctgtatacagtgaacctaccaggggaagccaga
gcttgcctgcaatcagggcataagatgctttacacaatcggtacagaagataaacaaaca
gtaatcagtgaacaggtaggcaccttgcaagagacgaacgtatctgctgctaatcttcaa
agggagcagatcacccgccaagctgctctgcttcagtcacacaaattagaagagagagta
tctgtggctcccactcagcctccttcttctacagtggctcctgtgagacagctcaatgtg
cccactttcacctccgcagtgcaggagagccaaggctttatagaacaacattatgatcac
attcaaagccctgtcatcgtagaactgaagatggctcaggaacgacatgcaaatatcatg
tctgcagttactgaaaaaattacccctctaaatagcatagaaacagagcttatgggtaat
aaaaaaagagaacagatacaagttcttagtcatcaagtggaaaccaggttacccattgtg
gatgagcaatcggaagtcatttcaaagccagagtttgaacaaagctacagagtcaaagaa
ggtgtgaaaatactatattccgctttggcgacggaaaagcagaaactgtctgaagcgcat
tctacagagtggtctatctctgaggcttctacgcaatcttcgactggaaaagaaatgttc
aagccagttctagcatctgtcactgaaattaagaatttgttatcaaaagaggacaaatat
gacatacatagactgaaagaagcaaaggcagtgccttgtaaagatgctgttcttaagtca
agtttggtatctgaagagaagcagattctccaggccgaacaaacgaaacaaataccagat
ttagaaaaggcacttactgtgcagtctcaaaaagaaaaaagagaaatcatgcatttacaa
attatgagagaccagggtacattaccctctgatggaagaattatttgtgagaaaccaata
gctgaacaaacagacattataaaacagcctaccctgttgcatacagttactactaatgaa
cagaattcagttacttgtgatctgtcatcacagttttcttcaaaggaaattcaatattcc
gttcagcctacaaaagaatctcttactcctttacatcttcagtctgttcacccagagtgt
gttttagctaaagaggaaatacttacagttgaaaagcctgaggaacaaatttcattatcg
aaacaggagagagtccgtagacaagcagtaagcattgaagagaaaaggaagctaacagca
gactattctacaaacattgatgggtcaataactggggtttgctctgtacttaaaacagaa
ccaaagcctcaaaatattctccaggtgatttcaaaaccagtggaactgcccaaggagacc
ccattcaccacagttgtgaaacagcagcgtgcattagttcagaaagaggatcagtgggcc
ttaatgcacctaatgaccacagaagacagtcaaactttacaggagggacacacaaatact
ttgaatgtagtagagaaatttagctgtgaagcaaaggttgagccttgtattccttgcgaa
ccagttaacatagaggagaaagcaatctcaactgaacgtagtgttgctttggaagctgcc
gaacaagattttgctgtcaaaattcaggaaggacaatcagttagaaaatctgtagtgatg
gcagagaatcaagtaataattggagaagtatctcaggaaataaataaatcagaggcaaac
aaagcttgcagtataaaacagtccaaagaagtgcttaccgtgcatgagacccaggaaagt
acagtattaccaaaagagcttacctttattattcctacttcaaaatcattcagcttggac
ataaagcatcagttaaaacatgcattgcaatctgcagtagcatgtgaacagccattgctg
ttagccgaagttgtgaatagtttggaagttgtagaggtaaaggaagttaaaatgctcaaa
gcacccaaatatgcaatgttcacataccttatcacaacaagcagcacacctttggaaatt
actgttgcatttgatggtgattacccccagactgctgatctaagaaatgagcttcaatca
actttatactctatgatctatcatgataaaccagtcctgacctctgaagagcctggaata
aaggagatagataagccactaagactgagggtcagcagcacgtcttccaaagaaatgctg
tcttctttgatagaaactgttggattttctgaaatggttggagacttttctgcagctaaa
ccccaatctgctgcactgaaggttgaatctcatgcttcttttgaaactgtcaaagctcat
caatccactgatgtatcactggcacaaatacctgtagaccaatctatagaaagatatgga
ggggagtttttgaaacacgctgttgtagctgaaagcccgataagaattacaaaagacttt
ccagttatagaaacatttctagagaacactgaagtagaggagcatagtatggtcagtttc
actgtgattgtaacatctgttacaaatgttaactggtatttcaatggacaattggttaaa
tctggcaaagagttcaagtgttataaggacaatgataattacacactagtaattgacaag
gttatcaaggagaagcaccaaggagaatatgtctgtgaagctgtgaacaaggctggcaag
agctcaacatcatcaaaactcacagtattcttaagagtaccgcctgtttttctgcacaaa
atccaacctttggaaatcaacgtcggcagtcgtgccagatttgaatgtgagattgaagag
gcacccaatgtaaaattcaagtggtttaagtctggcagtgagatgagagatagtgacaag
tgcaggatcatcagccatcacctgtcctcctccatggagcttttgaatccaactaaagcc
gaaagtggtgaatacacctgcaaagctacaaacaaatatggcagtgatagctgttcagct
tctctgaatgtagctgaagttttcccaccagtctttattactaagccagatccaacgact
tcatatgtgggaaaacaagcaagaattcagtgtgttgttactggttcatcaccaatgaat
gttgtttggcaaaaagacaacgttgctatttcttcgggaggaaactaccaaatttctgct
gacaagaaccgacatactcttgaaatagtgaaacttgctctctctgatcaagggacttac
caatgtaaagcctcaaatgttgttggaactgacatgtgtggcacagaactaagggtaatt
gacaagcctaattttgtaaagacctttacgtcaacatcagtagctctggggaagccattg
cgacttgagtgtcaggtagatgaagatactggagtggtcatcacctggactagggatggc
aagaagctgcatcactccatggatcttaaaattacttttgaggacaaagttgccactctt
gaaattcctaatacgaagcttaaagacagtgggaaatacagctgtacagctgcaaatgat
gctggcagtgattgctgctcttccacagtaagcgttcaagagtccccaacctttcttaag
agactggaacccaaaatcctctggaaacagggcataacggggcgaatgcaatgcactgtt
aaaggctcgccagagctacatataacatggttcatgaatgacaaagaaatcagccctgga
gagaaacacaagatgagcttcaaggatggccaagcagtcctagagatcttaaatcttatt
gtgacagatagtggaaattacacatgtgaagtgttaaatgatgctggctgtgaaagctgc
agcactgttttaactgtaaaagaacctccttccttcaaaaaagaattgcagatggtagaa
gtagttaagggaactacagctgtatttgaatgtgaagtaactggcacagctccatttgag
gtgacctggtgcaaaaataagaaaccaatttcttctgacaaaaagcataacataatctct
aattattctaaagtgattttggagatttattcatttgaaagtgtagatattggggattat
cagtgttttgtgtcaaatgatgttggtaaagtctcctgcaaatcaactggtaaattaaaa
gaacccccaacattttccaagaagatagaaaatacttcagctattgtgggaaattctgtt
agacttcagggaactcttaaaggttcatctccaatcacagtcaaatggatgagggattct
gaaattttaactgatgatgatcctaatgtaataatgacatttgagaataatgttgcagtt
ctggctatcaagactgtaagcataaaccatagtggcaaatacatttgccaggcagaaaac
gatgctggcaaacagcagtgtgaagctactgtgtctgttcaagaaccagcgagaattgtg
gataaaacagaatccattagtgtgactgcaggagaaccagtaagtttagagtgtactctg
tctggaagcccagaactcaaagtgaagtggttccgagacgggaaggaagtgacagccagt
cggaagtacaagatgacttttaaggataacgtggccattttgaaaattcttacggcagaa
aaaggagacagctgtgaatacaccttggaagtggcaaatcgtgttggaaaagaccagtgc
acatgttctgtcactgtcctggaacctcccatctttataatgaaacctgattcccaggag
gtaattccaggatccactgtggtcttacagagtgcttttactggtacatccccttttacc
attaagtggtttaaaggggagaaagaaatgtttaccggaggctcatgtttcatcaagaaa
gagtcaacttcaagtttcattgaactccattcagtgaaacccactgattcagacaattac
acttgcctagtggccaatgacgccgggaaagtgacttgcaccggcgtcttatttgtgaaa
gaaccaccaaagtttgtaatgacacctgagagtgctaaactggtaacatgtggaagtgca
gtgatcctcgaatgcagagtaatcggtagccctaccatcagtatcaagtggttcaagaat
gaggctgaaattagttctgatgacaaatatcaaatggccttcagtaactcagtagctact
ctgcagattgccaactgctctgttgataatagtggggattacgtttgtgaagcatcaagt
gaagctggtagtgaccgatgcaacagtgtaattacagtgaaagaaccacctacttttgtg
aaggctattgaatcaaaggaaattgtaaaaggatctgatgtcatattggaaggaataatt
tcaggatcatcgccatttgagtttacttggtatagagagagtaaaattgtgagaaatgat
aaaacacataagatcagcttacataatgatactgttagcctgcatattttaaaatgtgaa
gttggagatgctggaatatatcagtgcattgttacaaatgaagtggggaggacttcctgt
gattgtcaagtgagtctgaaagaacctccatcttttattcagaagatagagaacgtgagt
tcagttgtaggccatgaagtcactatgcagtgtgttgtgaaagggtccttaccaatcact
gtttcatggataaaagatgatcgtgaggtgaaagaagatgaaaatattaaaatttcgttt
gaggatcaaactggaaagctgcatattacaaatatgcagctaaaacatgatggaaaatat
atatgtctggcaaagaatgaagctggaagtcagaaatgttctgcctcattggttgtgaaa
gaaccagctaatattatcgaaaaggccaaatcaatcagtgttacagctggggatccagcc
acactggagtgcagcttttcaggaactaaaacccttaaagcccggtggttaaaggatggg
agggagttgaaatcagggcaaaaatacaaggttcacagcacagacaaacactctgcttta
aagattctctctgctgacaagagtgatggtggagaatacacttttgagatctccaatgat
gttggtagcagcacttgtgaagctgtgattacagttttggatcacataatcaaaccatct
tttacaaggaagctgaaagcagtagacagcattaaggggtcattcgcccatctggaatgc
cttgtttctggttcccttccaataattgtgtcctggtacaaagataatagagaaattgag
actgatgacaagcacaaatgcacattctttgaaaacacagcatttttggagatcagccgt
cttgatagttctgatactggcagttacacctgcattgccaataaccaagctgggagtgac
cagtgctctggtgcattgcttgtcaaagaacctccaagtattatcaaaaagcccgagtca
atggatgtcttgcctggaacaaaagtacagttcagtgtactttttagtggcactacccca
ttgaccatcaagtggtttaaagacaataaggaaattttatccagctcacattgttctgtt
cagaaggataattgctcaagtttactggaactcttttttgcaaagacatcagactctggg
gactacttttgtgaaatcagtaatgatattggctctgaagtttgtaaagcatcactcttc
gtaaaagagcctccaaaatttacccgaaagcctgagagcaccgctgtgattaaacttgga
gaaactaagaaatttgactgccaagtagttggcactcctgaaatatatatcacctggttt
agagatggaaatgagattagtcccaatgagaagtttaagatgtcctttgataactccttg
gttatcctggagatattcaatgccgatataaaagacagtggagtgtatttctgtgaggca
cgtaatgaagctggcagtgagagttgcagtatggagttgaaagtgaaagagcccccggcc
tttataaaggaattaacacctcttgaatttgtaattggctatgatgtctctcttacatgc
caagtgacaggcacatctccgtttgaggtgacttggaaaaaggatgctaaggaaataatt
tctaacaaaagacatatagtttcacagtgtaatgattttgtgatcttggaaatattcaaa
tgtgaagcattagatgttggtgaatatcagtgcactgtggcaaatgaagttggaaggtgt
tcctgcaccactgtgctgtctatgaaagagccaccatcatttgtgaagaagattgaaaat
attgccattgtcctgggaaaaatagctgaatttcactgtgttgtggcgggatcacctcca
ctgactgtccagtggcaaaaagatgaggactggattatagaggatgctaatattgaaagg
aagtttgagggcaatgtagcctctctaagaattgcagtctcagaggctagttatagtgga
aggtacacctgtcaggtatcaaatgaggctggacaagagaagagttttgcaactctagtt
gtgcaagaaccaccgcagattacagaaaaaccagagacagttaatgtgacggctggcgat
ccagtcagtctggattgtaaagtatctggcacacctgaactgaaagtcaagtggctgaaa
gacaacaaagagattacatccagcagatatcaaaagctcagctttgtgaataatgtcagt
tgtcttaagatacaatctgcacggattgaagatggaggcgattatacatttgaagtgacc
aatgattttggagtttctagttgcaaagttactttggttgtactagaacaacttattgct
ccatcattcctgaagccattaagggaaatgcaagaagttttgggatcttatgtgaaaatt
ctttgccgattttctggttcacttccaatatctgtggaatggcaaaaaaatggtattatc
attactggtaaaacaagatacaagcttgctcaagaagaaaacactgtttatctggagata
gatcagctagagaaggctgatggtggagaatatatttgtaaattaacaaacaaagcaggc
ttctgtgaatgccaaggtttgctgatggtgaaagagccaccaagcttcatgttgaaaccg
gagtcccaagctgtgcttcctaattcttctgtgcgttttaaaagtactctgaaaggaacg
ccaccatttatagtaaagtggttcaaagaagaaactgaattgataactggaccttcgtgt
tttattggactggaaggcttgtcctgctttttggatctttatgctgttcaagtctctcaa
agtggaatttatgtttgtcaagttagcaatgatgctgaacctcccaaatttgtgctgaaa
cttccaccaacaaagtttgtgaagcaagatgaaccagtgcttcttgaatgcaaagtaact
ggctctcccttacttcgcatattctggtacaagaatgaaaatatggttgctgcaggtgga
aactgcaacatgtcatttgtagactcattggcagttcttgaaattcccaccacaaaactt
gaggacagtggagtctacacatgtgaagttcagaatgatgctgggagtatcagttgtagc
actgcactgactgttaaagaaccaccatctttcctcaaagaaccccagcctgtggatggt
gtgaagggcagaaatgtcagtctagaatgtgaacttcttggcacagcaccctttgagata
acatggtataaagacaaaaaaacccttaaggacagtagaaagtacaagtttgtaaatgag
ggttgctctgttactcttcatattctgaatctagaggcttttgatgttggtgaatatcag
tgtaaagcatcaaacaatgttgggagcgcaacatgtactggcacagttaagcttagagaa
ccacccgcatttgtgaagaaattgtctaatctctcagtcatttgtggtgaagaagcaatg
tttgctgcatctgtcaaaggtttccaaccaatgactatctcttgggtgcaagataaagat
aatgttttgagagatggtgaaaaccacaagatttcctttgaggacaaccagattactttg
agaatttttaagactgatgttttgtcttctggcaaatacatttgccaggttaaaaatgat
gctggatcagtggagtcaatcgcaaaattgactgttctagaaccagcttcaattatggat
aaactagagtcattcagtgtcacagcgtgtgacacagctatattgcaatttacagtagct
gggacaccagaactgaaaccaaaatggtttagggatggtgcagagttatcctctggacaa
aaatacaaaattaccttttcaaaaatgatttccactctgaagattctgtcagcagaaact
aaagatactggagaatatacatttgaagtttcaaatgaagttggtagtgatacctgcaaa
acatatcttactgtcctagataaaatcttaccgcctacatttatacgaaaattgaatgat
actcgaatgatacttggtaaacctggtcagatggactgtaaagtctcaggatcacaacct
ttaaccatttcttggtttcatgatggaaaagagatagtaagtggaccaaaccatgaggtt
acattctctgacaacacctgcctgctaaacctacccagtcttaaactgccagattctggg
atgtacttgtgtagagctgtaaattcagctggggccagtgagaccagtgcctctttattt
gtcagagaacctccctcatttattgaaaaaccacaaaatatggaagtgctacctggcaca
aacattactttttcagccactgtaaaaggaagtgccccactaaaactgaaatggttcaga
ggtagtgcagaaattgtatctggaaaaggttgtgcaattgccttacggggtgatacagcc
actcttgaactgtttcaaatagccaagtcccatgctggagattatacatgtcaggtcagc
aatgatgctggaatggatgattgctctgttaatctttttgtaaaagaacctgcatatttt
gtgaagaaaacgaaggatcttgcagttgaaataggaaaaatgttgctgcttgagtgtgca
tatgctggaagcccggaaatacaagtaaaatggtttaaggatgataacgagatcttttcc
tcttataaatataacatcacgaccacagagagctcctgcatattggagtgtctcaacact
gacaaagatgacagtgggagatattcctgtcaagtttttaatgaagtgggaagtgattca
tgtcatgcacaagtctctatattagaacccccttactttattgaaaagttggaaccaatg
gatgtgactacaggagatgcagtttgtttgaaatgtcatattggaggcacacatgaaata
aaggtttcctggtttaaggcagatggaaaactgcgatcctctgctgcttgtaaaatagag
tttactagaggcattgcctctttgaaattaagtaaagctgtacaaactgatgctgatgaa
tatacatgtaaagcagaaaatagcattggatcagcctcctcaagctgtcgtttaacagtc
caagatgttaaaacaccaccttcctttcccaagaaaataatgagtctgcagcagactgaa
ggccagccagctagatttgagtgccgtattgcagggtcttctcctttggaggtttcttgg
cttaaagatggtgaacctttgaaggaaaatgatgaatactcaatgtattttgatgataac
actgctgttctaacaatatccagaggtgaaattaaacattctggtgaatatacctgtgtt
gctaccaatagtgttggaacagcatcttgtagagcaaagctcacactgcaagagccaaga
tatcctccagtctttgataaaaagctgcagcctgtggaagtttctgtgggagacagtgtg
gaccttgaatgtcatataacaggatctttaccgattaaagtgacttggtcaaaggatcaa
aaagatattcgtgcagcaggaaattataaaatttcatgtgtggataacacaccacatctg
acaattttgaaggcagataaaacaatttctggacagtactactgtcatgctagtaatgat
attgggaaggatacttgtagcactcatgtttcagtaaaagaatgcaaaattccaccatca
ttcaaaagaacaccttcagaaagtatcgaggactctgaggggaatctagtgaagctggaa
gggcgtgtttctgggtcccagcccataagtattagctggtacaaggacgacagtgaaatc
tacagctctgacagttatgaaatttccttcaagaacaacatagctctgctgagtattaag
agagctcagctttctgaccgtggcacttatacttgccaagcctccaatgaagctggcaca
gcctcctatcaggtgtctcttgctataacagaacgtaagatgtcccctgtgtttgatcag
cccctcaaaccattatcagttaacgagggtgagaagctgcatctgagctgtcatgttcgg
ggatctctaccaatgaatattcagtggatgaaggacaggaaagagataacatcttctgcg
aagactaggattacttttgttgatggcacagctacattggaaataagctctgcatctaaa
acagatgctggtgactatctgtgcaaggccaccaatgatgctggaagtgaattctgcaag
gccagagtggcagtacaagtggctccagcagctgttgatggagtcccagcaactgcggag
caagtcaagaaaactgacaacttgttcttcattgatgaaccaaaaagccttagcgttact
gaaaagggcaccgcaacattctttgccaaggttggtggagacccaattcctaccattaaa
tggatgaaaggcaagtggaggcagatcagtcatggtggtcgcatcactgttgaacaaaag
ggacaggatgccaagctggaaatccaagcattgaccaaatcagactctgggcagtacaga
tgtgttgcatccaacaagcatggagaaattgaatgcagcacagaattgaaagtcgaagag
aagaaagaagctgcactgcttgaaggagacttaagagctaaactgaagaaaaccccatct
aagcagaagagtcccaaggaggaccaagacattgacattgttgagctactgagaaatgtg
aatccaaaagaatatgagaaatatgcacgcatgtatggaattacggacttccgtggtctc
cttcaggctattgaatatctgaaaaaggagaaggaatatgaatctggaaaactggaattt
gaactcggagaaagggaatcagtcgaggactttgccaagttggtatctgatttgcaaagg
agaatggaacacacagagccaatcactttgctgaaggatattgcagatcaaacaacactc
acaaataaggatgcagtgtttgagtgtgagatcaaaatcaattaccctgagataagtttg
tcttggtataaaggaacacagaagcttgacagcaatgacaaatatgaaatcagtgcaatt
ggtgactgtcatcaactgaaaatcaagaactgtcaggttggagaccagggaaattatcgt
attgtgtgtggcccacacatctcaagtgccaaattaacagttatggatgacagagtggtg
gagcattcaaaacctgctgaccagatacattttacgaagcgtatccagaacattgtggtg
aatgagcgtcattctgccacatttgaatgtgaagtctcctttgacaatgcagttgttacg
tggtacaaagatacatgggaactcaaagagagtccaaagtatagctttcgaactgaaggt
cgtcggcactttatggtcatctgcaatgttacgtcagaagatgaaggcgtgtattcagtg
attgcacgcttggaaccaaagggtgaagctaaaagcacagctgaactttacttgtccagc
aaagaattttatataggaatggttccttgtgatgtccttgatccgtcaatacaagtaccc
gatgtgcaatcagatatctcccctggtgaaacaaaagatgagactgtgtcctaccgttat
aaagagaaaatcgaaatgcaagagtttgaaagctgggcagtttatgaagaaagaattatt
gaggaaacaacaaaagcatcaaagatagccattacggaaacagttccaacggttgcaata
gaaatgattgaggaagtgccaaggagagtgcatgctttggaagtggagtctgaacctgag
ataactgtcccagttatactaacagcaccaacatccacaaaagaacatgaagaactcaag
aaatttattccttgccctacaccagctcctactactcatcctgaagatgggctcacacct
gcagtctccgagccaaaacccgctgtgacccctaaaggtcaagcaaaaactgtagctcca
gctaaaactgaaccaaagcctacaccagcaacacaggctgtacctgaaccaaagcctaca
ccagcaacacaggctgtacctgaaccaaaggtgtatgagagtgcccagcaattctttgag
gaaaaagagatacttattgtagaagatgtatcacctgcttcaagagaagaaattagtttg
aagacagaagaaatccctaggcagaaagaaaccctacaagaaactgaagaaactgttcca
aagaaagtgctcccttacaagaaggaagagtttacaacaaaacaagaaagagtcccaaaa
actgaagctcttcctgacaaagaaccagacaagatcactatacctgaagtcactcctgtt
tcagtcaaagatattgcacctcctgaaggtaaaatttatgtagacgaggaaaaaatggaa
ctactgtccttgaagaagataaccaggatatcaaagggtgaggaagaggaaaaagaagtt
gtcacacttagaaaagtcccccgagctccagctgatgaaattccaaagacctcaagtcat
gccgaaaaagtcatagcctattctgaatctccaagggaaataacatttacaaagagtttt
gaagttaaagaagaaacttctaaaactgaagaaacctccaaaactattgtaaaaatccac
agtagagaagaaagggaatttattgaagtggttcagattaaggagcttaaggaaactacc
acaacagatggtattgtggaatcaaagttacatttaaataaagttcccactgatgaaaga
gaaaaagaagggttagggctgaagaaatctgtcaaagttgtaaaagaggaaacaccagaa
gaacctatgttaactaggaagaaaatatcaagacttccaaagacagatacagataaagag
actgtgaccttgaaaccatttgagaaacctgctaaacctgaaattgagaaggagaaagac
aaagaagaggaacccttgactttcattagaactgagagactgccaaaggatgatgtagtt
atggaacctatttcttctaaaaaggttgaatcggtgttagtcaaagaaggtggaagggag
gaggacagggaatctttagtcctcaggagaccacaaaaggatgaagcagataaagaacct
gttgctgctcctaaaaaagctgaagcagtgttagtcacggagagagaaaaagctttcaaa
gttatgacaaaggaagcaccagaagaatctagttcaactatgaagaaaatatcaagactt
ccaaagacagatacagataaagagactgtgaccttgaaaccatttgagaaacctgctaaa
cctgaaatcgagaaggagaaagacaaagaagaggagcctttgactttcaagaaatttgag
aaaccaccaaaggatgatgtagtcaaggaacctattgctcctaaaaaggctgaagcaatg
ttagtcaaagagaaggaaaaagaaaaggataaggaccccttagcttttaagaggctacaa
aaggatgaagcagttaaagaaccagatgctgctcagagagcaaaggctgtcaaagttgca
aaagaggaaacaccagaagaacctagttcaattatgaagaaagtgacaagacttccaaag
atggatacagataaagagactgtgaccttgaaaccatttgagaaacctgctaaacctgaa
atagagaaggagaaagacaaagaagaagagcccttgactttcaagaaatttgagaaacca
ccaaaggatgatgtagtcaaggaacctattgctcctaagaaggctgaagcagtgttagtc
aaagagaaggaaaaagaaaaggacaaggaccccttagctgttaagagactgcaaaaggat
gaagcagttaaagaaccagatgctgctcagagagcaaaggctgtcaaagttgcaaaagag
gaaacaccagaagaacctagttcaactatgaagaaagtgacaagacttccaaagacggat
acagataaagagactgtgaccttgaaaccatttgagaaacctgctaaacctgaaatagag
aaggagaaagacaaagaagaggagcccttggctttcaagacaattgagaaaccaccaaag
gatgatgtagtcaaggaacctattgatcctaaaaaggctgaagcagtgttagtcaaagag
aaggaaaaagaaaaggacaaggaacccttagctgttaagagactacaaaaggatgaagct
gttaaagaaccagatgctactcagagagaaaaggctgtcaaagttgcaaaagaggaaaca
ccagaagaacctagttcaactatgaagaaagtgacaagacttccaaagacagatacagat
aaagagaccgtgaccttgaaaccatttgaaaaacctgctaaacctaaaatggacaaggaa
aaagacaaagaagagaaacccttggctttcaagaaaattgacaaaccaccaaaggtggat
gtagtcaaggagtctattgctcctgaaaaggctgaagcaatgttagtcaaagcgaaggaa
aaagaagaggacacggaaccctcagccctcaagaggtcacaagaggatgaagcaattaaa
gaacatgttgctgctcctaaaaagactgaaacagtgtcagtcaaggtgaaggaacaatct
gtagaagttgccaaagagaaaacacctgaagcagctagtttaagacttccaataaaggat
acagataaagaagcctttcatttcaagggaactgagacaccaccaaaggatgaagttaaa
gaacctggtgctggctttagaaagactgaaaaaattctggaagacaagaaagaacaagaa
aaacgtaccttggaaccacctgaaaaaccacctgaacttgataaactatcgaccaaattg
aaaacaccttcaatagatgaacaggaaagggaaaaagtagagctgaagccattttcagaa
gcacctaaacctgaagtactgaaggctgttccactgaaagcagataaaattagtggaaag
gatgttcctctaaaaatgaccacacacttaccaaaggaacctgatgaaggagaacaagaa
atattactcaagcctgtggaggtatcaaaagtaggcttggaactgagaaagagtccttca
ctgaaagttgaaaaaccagtaacagtagaactgacacctgtagagcgaaagtccagtgta
gatacccataaaacattacccaaaaaagtgtctcctaaggactccattgattcagttact
ctaaaaacaatcccaaagaaaacatcaccaccagaagaaaagactcctgaagatactcgg
ctaaaatttgggaaaggaatgacgctagaaaggaaagaactgtctcctcaatttgtgcag
ctcaggagtgttcctacccaacaagaggatgaagtttccaaagaagagcctgacaagcag
gtagaagatgaggggaaaattttaggatcagaactcagttctcatgagagttatagttct
tatggttcagaagattgggaagtaacttcccaagtatctgaagagggtgcgcttgagact
ccaggaatgaagggtgacagacgagatggaaaaccaaaagaagaaccaggaaaaggtaga
ggcctattagcaagacaaacaccatcccctggagatgctgacaaaaggaaaggcatgaaa
actggtgcagggggtgacaaaccaccaggagatgcaccatttggattccagcttaaggct
gtccctttgaaatttgtaaacgggttgaaagacatagttctacaagaagctgagtcgatt
ggctcctccgctgtatttgagtgtcaggtgtctccctccactgctattactacatggatg
aaggatggaagcaacttaagagaaagccctaaacacaagttcacctcagatggcaaggat
cgtaagcttgccattattgatgtccagttgtcagacactggtgaatatacttgtgttgct
aagctgggaaacaaagaaaagacttccacagccaagctcattgttgaagaactccctgta
aaatttacaaagaatttggaagaggagatgtcagttctcaaaggacagtcattgtattta
acctgtgaattgaacaaagaaaggaatgttgtctggaaaagaaatggtatacctcttcaa
ccaattccaggaaagatagcaattaatgtcataggactgcaacattctattacaatccag
aacacagaaaatgaagatgttggtatttactcatgtgagtatgaaaatctcaagactcaa
ggagatattaaaattattgaaataatcagagattggctgatgaaacctttgcgagaccag
catgtaaaacctaaggccactgcgaccttcaaatgtgagctattcaaagacacacctaac
tggaagtggttcaaagacgatgatgagatttcaaaagagccaacagataaaaccgaagtg
aataaggatggaaggaatatctctctcatgattaagaatgcagctcccgatgatgtggga
gaatatactatagaggttgaaggccacagatacccagctaaactaactcttggagagcgt
gaagctgagatcctaaaacctatctccagtgttgaggtctttgagaaggaaaatgctacc
tttgaaactgaaatttctgaggaagatgttgcaggagagtggaagcttaaagggcaaatt
ttgacacgatcacctacatgcgatatcaaaatggaaggacagaaaaggattatcacttta
aaaacacttgaagttgatcagtctggtgaagtctcgttccaagcactgaatgccatcaca
actgcagggctcacagtgaaagaaattgaactggacttcattgtacctctgaaggatgtt
tctgtaccagaaaagaaacaggcccagtttgagtgtactatcacaagagatattgccaag
gtcatgtggatgaggggatcagatatcataacatcaggaataaagtatgacattattgat
gatggaaagaagcacatgctggtcatcaatgactgtgaattcgatgatgaggatgaatac
actattgaagtcttggacaaaaagtcaacagccaagctaacagtggaaggtgtgaggctc
aagttcattacacccttaaaggaccaaacagtgacagagggcaaaacagctcggtttgag
cttgagctcagtcatgaggatgtaccagtgacatggtacaaaaatgaaatcaaactgcat
ccgagcagaactgtgcttactcacgttgatggaaagaagcacatattagaaatcaaagag
gtcactctagatgacacctgccaaatcaaagcagaggctaaaggagtatccacaacggct
aatcttttggttatagaggctgatccatacttcacagttaaattacaagattatactgca
ggagagccgtacttcatcaccaaactgcaggactatactgcagtggagaaggatgaagtg
gtgctaatgtgtgaagtgagcaagccggctgctgcagtgaaatggttcaaggatggcaag
gaagtcactccatccaaaaatgtactaatcaaatctgatggcagtaagcgtgtgctgatt
attaggaaagcacagaaggatgacattggggagtatatttgtgactgtggctctgaaaag
actactgcacaacttgacatagaagaacgtgaaattatggtcatacgtcctttgtccagc
atagaggtgactgaaatggagtctgcacgctttgagttagacatctctgaggaggatgtc
catggttcctggaagctcagaggagagactcttcaccagtctgctgattgtgaaatgaag
gcagtgagcaccaggcatattctgatcctctacaatgtgctcaggaaccaggctggtaca
gtagactttcaagctgccaatgctaaatccagtgctcacctcaaagtaaaagctcgggtg
attgggcttttacgaccaatcaaagatgttacagtgactgctggagaaactgctgctttt
gactgtgaattgtcctatgaaggaattgaagttgaatggttccttagaaacattaagctg
gagtcaagtgagagggttgtcattcgtatggatgggcgagttcataccctgatgctcaga
gacacagcactgacagatgctggagtggtagaaataagggctaaagactttgtcactcag
gctcaactcattgtgaatgaaccacccgttgagtttactaaacctctggaagaccaaact
gtagaggaagaggccactgccattttggagtgtgaagtctccagggaaaaagcagaggtc
agatggttcagagaaggacaagaaatccacaaaactaagaagtatgacattgtaactgat
gggcgaaagagaaagctcatcattcagggctgcacacttgatgattccaagacttacacc
tgtgatgcaaaagatttcaaaacatctgccttccttaatgttgagcctccacatgttgag
ttcactaagccactccatgatgttgaggtgaaagagaaggaagcagccaggtttgaatgt
gaagtttctcgggaaaatgcaaaggtgcgatggtttaaagatggcagtgaaataagaaaa
ggcaagaagtatgagatcattgccaagggtgtccagcacattcttattgtcaacaaagca
gtctttgatgatgaggctgagtatgaatgtgatgctaagacctctaaaacttctggaatg
cttactgtcattgaggaagaagcagcgtttacaaagaatctgtctaatatagagggcact
gaaactgacagcattaagatggtctgcgaggtttcaaagcccagcgcagacgtcacatgg
tacaaaggtgaacaggagctacctgagggaggcagatatgaacagatcgtagatggcaga
aagaggatacttatcattcgagacctctgcatggacgacactggagagtataactgccgc
ctacctagctcacgaacctcagcaacactgaggattaatgaactggctgctgactttata
tcaagaccacaaagccaagaagtggttgaaggtcaaaaggcggagtttgtctgttcagtt
tccaaagacacatatgaggttaaatggctgaagggtgacaaggagcttgaagctggggaa
aaatatgacattgtttgtgatgggaagagaagggcactaatcattaaggactgcctgcta
caggatgagggaccatacgttgcccttattggcactacaagggctactgcagaactgttt
gtcattgaaaagctccggattataacacctatcaaagatactgaaacagatgaaggccag
gaaatagtttttaattgtgaggcaaatactgaaagtgccaaagcaaagtggctgaaaaac
aatgaaacaatttttgacagtggaagatgtgtcatgtctcagaaggacaatgtgttttct
ctgagaatcagagatgctcagaaatctgatgaagccaactatacaataacattaacaaat
cagcgtggtgaacatgctcagagctctgcccaactcactgtacaagaggaggatctaagg
atcattgagccccttgaggactgtgagactcaagaaaagaggacagttaccttctcttgc
aaagtgaataaaccaaatgtaacagtacagtggatgaaggcaggtgaagagatcaccttc
aacaaacacatctcgtacagagtggataaagataagcacatgttgactatcaaggagtgt
agcttggctgatgaagctgaatactccgttattgctggttctgacaagtccacagctgag
ctgattattagcgaggcaccgactgacttcctaacaaaactcgtggaccagactgtcacc
gagtttgaagatgctgaattctcctgcatgctcaccaaagacaaaggagaggtcaagtgg
tacaagaatggccgcgagatcaaagaaggacccagatatttctttgagaaagaaggcgag
atgtgcaagctacatatcaaagaatgtagacctgatgacgagtgtgaatatgcctgtggt
gttaatgagaagcgtataagggctagactttttgttgaagaaatcccagtggagataatc
accccccctaaagatatatttgaagctcctggttcggatgttatttttgaggttgagctc
aacaaagacagagttgaagtaaaatggctaaggaacaatatggtcattgtccagggtgac
aagtaccaaatgataagtgagggcaaggttcacaggctccaggtctgtgagataagaccg
cgtgatcagggtgattatagagtcatagctaaggacaaggatgccagagccaaattggaa
ttagcagccgtgccaaaggtgaagaccacagatcagaaccttgtgattgatgctggaaag
ccttttaccatgatagtcccctatgatgcttatcctcgtgctgaagcagaatggttttac
aatgagatttatctacctgaagagaatattgacacgtttactgacagaacagaatacaag
ttaaatgaaccagagaagtctgaccagggcagatacaaaattattattcggaacaaacat
ggaaaggcagaggctttcattaatctggaggtcattgatgttcctggacctgtacaaaat
cttgatgttgtggacaccgctgatggtgaggttagtcttgcctgggatgagccagaatct
gatggtggaagcaagatcattgcctacgtagtcgagagacgcgatattacgcgcaaaagc
tggactatggtcactaaccgtgcagaggaccaagagttctgtgtgacgggactgaacaag
gactccatgtaccttttccgtgtctgtgcacgtaacagagtaggaaatggaccaaatgtg
gaaactgagaatcctgtgcaagctaagaacaagtttgatgttcctgaggcaccacagaat
gtcaatgttagaaacgtgaataagtttggtgccactctctcctgggagcctcctctgtat
gatggaggatcagaaattacagcatacattattgaacttcgcgatagaacatctgttaga
tgggaagcagctttggtgaccaagccagaagactgcacagctgtcatcaatgatgttgta
gagaataaggaatatatcttccgagtaagagctgaaaacaaagctggaattggaaagcca
agctttgctactgacccagtgaagatcatggatcccattgagagaccaagtcccccactg
aacttcagttacactgaccagacaagggactccattcaactgacatgggagacacctcta
agtaatggaggcagcacaatcactggctatattattgaaaagtgtgaggatggaacagac
aagtggttcagatgcaatgccaggctttgccaggaccttagttataagctgactggcctg
aaacaaggacacaagtaccattacagagtgtcagctgaaaatgcagcaggtgtttctgac
ccagctgaccagattggacctctcgtggccgatgatccacatgttgcccctactatggat
ctaagtgcttttaaggatggtttagaggtaatcgtccctcatcctctcattatccgcatc
ccaattactggataccccttgcccactcctcactggagtgtgggagacaaggagttggct
gcaggagacagagtgtccatggtcaccaaaagcacatttacggaactcatcatcactccc
agtgtccgcccagataagggcatctacactatccatcttgaaaatgatgcagccactatc
tctggagagattgacgtgaatgtcattgcatccccaagtgcacccagagacttcaaagtt
gcagaagtgaccaggcgtcatgtacatttgatgtgggaggcaccagagcatgatggggga
agtccactaactggctaccaggttgaaaaacgtgaagcatcacgtaaaacatgggtgaag
gttatcagtggtatacaggaccaggaatactctatcacagatgttactgaaggcaaagag
tatctgttcagagttactgcctgtaataagtgtggtccaggagagcctgcatacatcgaa
gaaccagttaatgtctcctccccagctactgttcctgacccacctgaggacctgaaatgg
agagataagtctgctaatggaatcttcttatcctgggagcctcctaaatatgatggtggc
tctgtaattaaaggctacattgttgataagtgccagcgtggcactgacaagtgggaacca
tgtggtgatcccatacctgagctaaaattccaagttactggcctcactgaaggacaatgg
tatgcttaccgtgtcagagctctgaacagactcggtgctagtcaaccgtgcagggcaaca
gatgaaatcttggctgttgatccaaaagagccccctgagatcatgctagatgtaaagctg
cttgctggcttgactgccaaggctggaactaagattgagctacctgctggtgtgcttggc
aaaccagaacccaaagtcacctggaccaaggctgatgttgttctgaagccagatgataga
gttgcaattgacactaaacctggccattctatggtgtctattgccaaaacaacaagagac
gacacagctacctacatcattgaggcagttaatagcagtggccgtgctactgcaactgtt
gatgttaacatacttgataaaccaggccctccagctgcatttgaaatctctgacatcacc
aatgaatcctgcttcctcgcctggaatcctcctcgagatgatggtggctcaagagttacc
aactatattgtggagagaagggctgcagacagtgagacgtggcacagactatcttccaca
gtgaaacagaccacattcaaagcctgcaatcttacgtctcagaaggagtatatcttcaga
gtgtttgctgaaaaccagtacggtattggtctccctgcagaacatgttcccgttgttgct
aaatactcctttgacccacccggtgccccaagtaaattggtcccctctgatattgctaaa
gactctttgaccctgacatggtatgaacctgatgatgatggtggcagtcctatcactgga
tattggattgaaaggtatgatccagaaaatgacaagtggataaagtgcaacaagatgcca
attcaggatacctcttacagggttaaaggactacccacaaagaagaaatatatttttcgg
gtcttagctgaaaatcttgcaggactcggaaaaccaagcaaagagaccgaccagattttg
gtcaagaatccaattgatgttccatgggctcctggtaaacctgttatcaaggatgtggct
aagacttcagctctactgcagtggaccaaacctgagcacgacggtggggccaaaatagat
tcctatgtaattgagttacttaaaagtggaactgaagactgggtgcgtgtggccgaagat
gtccccatgactgagcactttttgaagggtctgatggagaaggaagagtattcatttaga
gttagagctgtgaactctgcaggagagagtgaaccaagtgaacccagtgacactgtgacc
tgcaaagagagactttatccaccttcacctcctcgctggcttcaggtagttaatatcact
aagacagatgctgagttgaaatggacggttccagagaaggatggtggatctcccattaca
aattatattgttgagaagcgagatgtgagacgaaaggcctggcagacggtagataccact
gtgaaggagaccaagcacaccgttacaccactaaatgaagggtctctttatgtgttccgt
gtagcagctgagaatgcgattgggcagagtgaatactgtgaactggaagactctgttctt
gccaaggatactttcactaccccagggccaccttatgcattaattgtgctggatgtaact
aaaagacacgttgacctgaagtgggaatctccaaagaatgatggcggtcgacccattacg
aaatatgtcattgagaaaaaagaaaaactcggaactcgttgggtaaaggctggaaagact
caagggccagactgcacataccaggtgacagatgttgatgaaggaagcgaagtgcagttc
caggttcgggctgagaatgaagctggtgttgggccaccaagtgaacctacagatgtactt
agaattgaagatccaataagttcaccatcgcccccactggacttgaatattactgatgct
agcagacaccatatatccataagctggaagccaccagaaaaaaatggtggcagccccatc
cttggctaccacattgagctgtgtgaagcaggcactgagaagtggatgagagtcagttca
cggccagtgaaagagctaaaattcacagccattgaaggaataataccagagaaacagtat
gtgatgagagtccgtgcaataaatgctattggaatcagtgacccctctgacgtctctcag
agtatctatgccaaggatcctgactgtgctcctaccctagatttaatcactgaagacatt
attgcaatagaaggggataaattacagctgccagttccatacagtgctgtaccgttaccc
acggtatcctggaaaaaagatggcacagacctcaaagctgatggccgagtttccctacac
tgtgaacggtctgctgctcgcttggatatttccaaatgtgtccgtgctgatgctggagtg
tacgctatcactctggaaaacaggcttggaacgataagtggaacattaaacgttaaagtc
attggtattcctggcccttgtaaagatattgttgctagtgaagttactaataattcctgc
aaaatcacatgggagcctccagaggatgatggtgacagtcctattcttcactatgttctt
gaacggagggaagcttccaagaaaacatacaggcctgtcatgtcaggagaaactctgagc
tgcattgttaaagacttgcttgttaatgcagaatactacttccgtgtccgggctgtgaac
aaggttggcagtggggagtatattgagagccgcaatcctgtaattattgaggatcagaag
gatcgtccagatccacctaccaaagttgaggcccataatgttactgcccattctgtaacc
ctcacttggaaaccaccaatatctgatggtggtagccccattaaaggttatattctggag
aaaatcacaaaagatggtactcgatttgaaagatgcaatgaaatcctggtgcctgggttt
tcatacacttttgaaggcttgaaagagggagaagaataccagtttcgtgttcgtgctgag
aatgcttttggaattagtgatccttcttctaccacaccgctagtgaaagctgcagaccct
gttgaactccccaaggtttctctcattggaagcctcagcttcaaaaaaggtgaagagatt
actatagatgcctatatctctggatctccatacccaactgtgacttggttcagaaatgat
gaagtcattaagctggagacaataaagaaaccagtgaaaccaactatgaaaaagaagagt
aaggctgcttattctgagcccgaggagccataccacccaccccttaatgaacgggtttct
tttgatcccagcaaaaagggtgtggccattgtgatgatccgtgattgtgttagaagtgac
catggagtgtacatggctaacgtcgagaatgttcatggtagtgcaacagcatcatgtgac
attattgtccttgatgtaccaggacctccagttaactttacttttgaagaaatcaggaac
acttctctcatttgtaaatgggacccacctaaagatgacggtggtagtgaagttctgaac
tacattttggagaagaaagacaacaccaaagacgacggtggatggattactgtgacttca
acttgcaaaggatgtaaatatcctgtaacaaaattgattgaaggcaaggagtacctcttc
cggatttcagcagaaaacaagtttggtcctggacctgcatgttactcatcaccagttata
gctaagaatcaatttgatccccctgatgcacccaatatgccacgagtgggagaagttact
gaaaacagcatgcttgtaagctggaatgagccaaaagacaacggcagtcctgttttgggg
tactggattgagaagcgagaaatcaatagcaaatattggaccagagtaaataacaacctg
cttaattcattgaaagtcagggttactggtctactggatggcatgacctacatctttaga
gtttgtgctgaaaacttagctggacctggaaatttcagcgtgccatctgaaccaaaagtc
gcacaagatcctattctgccgcctggcccacctgttccaaggattgttgatactacctca
tcttccattgaactgacttggaagccccctttgtacaatggtggtggagacattcttggg
tatcatgttgagaaagttcttgcaggagaaaaaaattggtcccgctgcactgagagacta
tgcaaagactgcaagcttaccatttctggactgacagagggagctgattatattatccgc
gtgtttgctgtgaatcaggcaggtgaaggagcacctggcatgactcaacctgttatggtg
aaagaaccacaagagactccattcgtggaacttgacatatctgtgaaaaatggtgttact
attcgagctggggagacactgaagttacctgcctatgtaaatggtagacctcagccagaa
gtgaagtggacaaaggatgaaagtgatcctgtcaaagaacatgttatgatcgaaactatt
ggaaaaaacagcactttaagtataaagaatgctttgaggtctgaccatggcatataccag
attactggctcaaacagcagtggaaccaaatctgcatttactagagttgaagtcttggat
gttcctggtcctgtcattgacttgaagaccaatgtagtcacaaaaaaggtgatagcacta
agctggtcagaacctgcagataatggtggaagtgatatcacgagctacactgttgaaagg
agagatgcaaagatgcacacatggagacagccaattgagacacctatgtgtaaatgtgaa
attagagggccgtttgatggaggggaatatatgttccgtgttgtagcgaaaaacaagttt
ggttgtggtgaaccagttgatctgggccctattcttgcaatagatccaaaaggtacccca
actgcaccagagagatttcgttttacggaaagaaccaaatcatcaataactctgtcttgg
aaaccacctcaaagtgatggtggcagtccaattcgaggatattatgtagaaaagaagaga
aaagatggaactgagtttgagattgccaatcgtcagatatgtaaggatctatttttaaca
ctggagaacctctccgaacgtcatatgtatgacttccgtgtcaaagcagtaaatgatatt
ggagatggagagccttcacttacattaagtgctgttattcaagatgatgaagttaagcca
actgtgacattgttgaagtacttcaagagtggtacaatcactgctaagaaaggagaagcc
attgaaattcctgcagaagtgataggaatcccaatgcccaagagtgaatggtcaagggat
ggaaatattattgaggaacaaacagaaaaatttttgattaatactgaggtgctgagttat
tcaaaagcacacacaacgctaagcattcctgaaactgatcggaaagatagtggcctttac
acactgactgcttcaaatcaccttggatctgcatatgagaacatcaaggtagagatattt
gaccgtccaatgccaccacagaacattgtagtctctgatatcacaaatcaaggatgttat
cttacttgggatgctccagaagataatggaggtagtgaactcacaaattatattattgag
aaaagggatgccagcaagaaaaaatcagattgggaggagataactgacagtgtcattgaa
aggcgttatagggtatcaaaacttgaaaccgataggacttaccagttcaggatcaaagct
gagaataaatatggagttagtgatggatgtgaatcagagaaagtcattgtcaaggatctg
tatggcctccctggtccaccacaaaacccaaagatcgctgggtgcactaggacttccatg
ttggtaacatgggaaccacctaaggataatggcggatccacaatcacgggttactggctt
gagaagagagaaaaaggagctgtttactggaatcgtgtgaatcgggccccaatcacaaaa
ccagcaattaaaggcctagaatttaatgtacaccacctgaatgagggtactgaataccag
ttccgtgtgatggcatgcaatgctgctggtgttggacctcctagtgaaccgactgagagt
gcatttgcaactgaccccaagaatcctcctggaatgccatcaagcccagaagttgcacat
aaaaccgatgatagtgtcacacttacttggaatccaccagataaggacggcggaagcccc
atcaaaggctacattattgaagttcaagatgaagattcattacaatggagaagagtcaat
gaatcagacaaaccacatcctgataataaatttactgtacctgatcttcaaaaaatgaaa
aaatacaaatttagaattattgcagtcaattctggaggagagtctgaaccaagcccagga
acttctcacattcttgttaaagagatattggaggaaccaagaatcactttggatatcaat
gccaaggagttactctcctgtcgggctggttccacaataaaaatccctgcaattatcaca
ggatgtcctactccaaatgttacatggcagtatgatggcaaagcaatatctgaaaagaag
gagggtcttcattttcttccagtagagtcacagattagatcaattgacactacatcaacc
gtcacaattcctgacagtacattatgccattctggaacttatatcatatcagctgaaaat
aaagctggacagaaggctgtgaaagtcagagtcaatgtactcgatttaccaggacctcca
aaggatctcaaagtttctgatatcacaagaggcagctgtagacttacatggaagcctcct
gataatgaggggggcgaaagaatcaagagttactatattgagaagaaaactgttgaagga
aaggcttggacgaaggttaatcctgcatgtggaagccagtcatttgttgtgtgtgacctt
attgagggacaagagtacctgtttcgtgtcagggcacaaaatagccttggcttgggacca
cacactgaaactattcagcggacaaaggcgagggatcccatacaccctccagatcctccc
ataaaggtcaaaattaatcaagttaccaaggacacggtgacccttacatggaagccaccc
atcaatgatggtggagctcctgtgacacattacattgttgagcgtctttgctgggacacc
agtataacacaaaaggagtcctggaggcaatgcaatcgacgtgatgttgaagagaccact
tttaagattgaggatcttaatgaaggcggagaatatgaatttcgtgtcaaagctgtgaat
gaggctggagcaagcaggccttcctcaactgctgggccagtcactgttaaagaccagaaa
tgtgcacctagtattgaacttgacacattcatggaagttgaacaaggaactgacatcaaa
attgttgcaaaaatcaagggttgcccattccctaccctaacatggcaaaaggctccaccc
tacagaaaggatgagaagactgatgtagagtatgatgagcacatcaataagcttgtgact
gataacacctgcgcacttctgattaagcaaggaaaaagagcagacactggtatttacaca
atcacagctagcaacagtctgggtaaagcctcaaaggaaataaggctcaatgtattagga
tgcccaggaccaccttgtccacccatcaagtttgaagaagtctcctcagggaagattaca
ctgtcttggcttcctcctaaagatgatggagggtcaaagattactaattatgtcatagag
aaacgtgtggctaacaggaagacatggatacatgtaaccaatgaacccaaagagcgggtt
tacacagtggagaatttgatcgcaggccatgaatacgtgttccgtatcatggctcaaaac
aaatatggtattggtgatcctcttgacagtgaaccagagaaagccagaaatctttgcact
gttcctggtcaatgtgaaaaaccaaccatttcaagtgtaacccataactccatgacagtt
aactgggaagagccggaatatgatggtggaacaccagtgattggttattggctagaacga
aaagagacgacatccaaacggtggaacagagtaacccgtgacccgatcaaagttatgcct
tttggtgtatcacataatgtaagtggtctcattgaagggtctcagtaccagttccgtgtc
actgccattaatgcagtaggatgtggccctccaagcttgccatcagatcctattactgcc
acagacccagcagctccgccagatcctcctatacctaaagttactgactggacaaaatca
accgttgatctggaatgggttccaccattaaaagatggtggctcaaagattattggctac
attgttgagtacaaagaggaaggtcaagaagaatggggcaaagctaaagataaggaagta
agaggaacccgacttgtggttgatggactaaaagaactgggacattacagatttagagta
agagccataaatactgcaggtgttagtcaaccgggtgaagtgccagaggtgattgaactg
aaagacagaataattgctcctgaggtgaacctggatgccacaatgaaagagaggctggtt
gttcatgctggtggtgtgattcgtatcctggcctttgtttctggaaagccagcaccacag
attacatggaatagagatgacggtgcattaccagaggaagctgcgattgagacgactgca
atcagttcgtctttagtaatcaagaaatgcacacggaaacacaaaggcatttatacactc
actgctaagaatgacggaggtgaaaaaaagaagagcattgtggtggatgtgttggatatt
cctggtccagttggcgtgccaatcactgcagagaatctcactagtgactcatgcaagtta
aactggttctatcctgaagatgatggtggttcagctgttactaatttcataattcaaaaa
cgtgaagctgaacgtaaggcctggaccccagtgtcttgcactatcactagacatgctgct
gttgttcgtggtcttgttgatggaaaggcttatttcttcagaattgcggctgaaaacatg
attggaataggtccatttactgaaaccacttcagaaataaccatcaaggatcgttttagt
gtaccggaccggcctgaagatctggaagtcacagcagtcacaaaggactctattactttg
acttggaaaccacctaagaatgatggggggtctgaaattaccatgtatgtagtagaagcc
cgaccaattggcaaagaaaagtttgtccgactcacaaaagagaagctgcttgggaggaaa
ttcacctttgatggtcttaaggcgggtgacacctatgaattccgcattagtgcagtaaat
gaaattggtcaaggaaaaccttcctttaacaccaaaccaattacttgcaaggatgagcta
gaaccaccgacaattgagcttgatttccgtgacaaggtcattatacgtgttggcgaatct
tttgcactacaaggtcgctacactggaaagccagcaccgtctattatatggttcaaggat
gataaagaattacaggccgataaccatatcaaactgaagaacactctaaccacaatgtgc
ttaggcataataaaggctaagcgtgaacatagtggcagatattgtgttcttgtagagaat
tgtacaggttcacggaagggcatttgcaatgtaactgttgttgatcgtccactgccacca
cagggaccagtattgttcaaagaagttcacagagatttcatggttatttcctggaagccc
cctcttgatgacggtggttctgagatttctaactatattattgagaagagagacacaaag
agggatctttgggcaactgtgacatctgcctccacaaagacaacatgcaaagtacccaag
ttaactgaaggaagggagtatatcatgagaatctgtgctgagaatatgtatggaataagc
gatccactggaatctgaagagatgcgagccaaagatctcttcagagtgcctgaggcaccc
gagcaacctgttgttaaagaggtgtacaaagacacagctcttgttaactggagtagacct
cgtgatggtggaaaaccaatcactaactacatcttagagaaaaaggagacaacatcaaag
agatggtcacgtgctacaagagaacccatatacccagacacacagttcagagttcaagat
cttactgaaggctgtgaatatgaattccgtgtcatggcagaaaatgaaataggtgttgga
gatcctagtccaccatcaaatcctgttgtagctaaagatccaattgtaccaccaagccca
cctgtgctcccagaagctgtggacaagactaaagaaactgtaagtttaacctggcagcca
cctcgtcatgacggaaaaggaaaaattcttggctatctagtagaatatcagaagattggt
gtggaagaatggaaaaaagcaaatgagactgctgaatcatgcccagaaaccaagtttaca
gtacagaaccttgaagatggagaaatgtacaggttcaagattatggcagtaaacgctgcc
ggtaaatctgatcctgcatatgttaaggatcctgtgaaagtacacgacagacttgagccc
ccagagcttctacttgatgcgaacatggctcgtgagcatcttgccatggtagggactgat
atcattctcagtgcaggaattaagggtgtgccattccccaaagtcacatggaagaagaat
aatgaagaggttccacctagagctaatgtggaggttactggtgtaggaagtaaactacaa
atccataactgtcttcgctctgattgtggtgattacacaatttctgtggaaaattctgca
ggttctaaagcagctacatgcacagttcttgttttagacaagcctagtccacctcggaat
ctgtccgtttctgagattacaagagaatcagcctacctttcctggaatgagccagaggat
gatggaggtgctgttatttctaactatgtgatagaaaaaagagatgtggcttcagataat
tgggtacctgtttcttcttcatgcaagaagcctagcttaaaggctttgtacttaatggaa
ggaaaccaatatatgttccgtgttgctgctgaaaatcagtttggcagaagtgaatacatt
tcaactaccaaacccataaaggctattgatcccctctacccacctggtccacccaagaat
ttgcatcatgtggatgcagataaaactgaagtctggcttcagtggaatttgccagatcgc
acaggaggtagtgatattactggatacctagtagaataccaagaagaagaggaaaaagac
tggattacttttaaaactgtcaaaaagactgaatgtcatgtgacgggacttgaagaggga
aagacctatcgattccgtgtgaaagcagagaatgctatcggtctgagtcgtcctgataca
acagtacctattctgtgccaggaaaaacttgtggcaccaacaatagaagttgatgtgaag
ctaattgaaggaattgttgtgaaagctggaagcacaatcaagcttcctgcaattatgaaa
ggcattcctgttccaaatcctaaatgggttacggatggcaaggaaatcaaaagtgaaggc
aatgtgctgattaaaactgatcactattcaactactgtcaccattaaggactgtaaacga
caagacactggagagtatcttctcacagtttccaacccagctggaagcaagacagttgct
ttgcatgttacagttattgatgtcccaggtgcacctactggcccagttaacatgcttgag
gttactcctgatttcatggtcatcaactggcgtcctcccaaggatgatggtggaactcct
ttgatgaattatattgttgagaagaaggataccaagaagccatgggagccatgggcagta
gtaagctctggaagcattaatacaaaagctaaggtttcctatctggagaaaggccgcgaa
tatgtaatacgtattcgtgcagagaacaaagttggtataggtgctgcccttgaaagttca
cctactattgccaagcgtatgtttgacccacctagtgcaccaggccaaccagttgctcaa
gatatcacagaaactgctgtgactattcagtgggaagcccctttatccgatggtggcagt
ccaatcattggttacattatcgaacgtagagaaatgacaggtaaatggattcgtctgaac
aaaactcctgtcttagataccagatacagagcatctggactttttgagggcaatacctat
gagtttagagtatttgcggaaaacattgctggcataagtgaaccttccccagtgtcagat
ccagttaaaactacacgtcccatcacttgccccggtcccccagtgaatgtcaaacttaag
gactggagcaaatcttatgcggatttagtctggactaagccttcaagagatgggggcagt
cctatattaggttatattgttgaatgccagaaatcaagcagtaaacagtgggatagaatt
aataaggacgaacttattaaaccgtgtgcatatagagtgccaggattgattgaaggcatg
gaatacaagattcgtgtaagagcctgtaataagattggagaaggagaacctaaagaactt
agtgaaacagttattgcaaaagacatccttattcctccagaggtaattgttgacgttgct
tgtcgtgatctactgacagtcagagcagggcagaacattaacttagttgctcgtgttaaa
ggaagacctgatccagaaattacctggactaaggatgcaaaagtcttagtccaagacaag
cggactgagatgaacaacaattacccacttgttgatatgatcataaaagaagcaactaga
gaagattatgggaaatatgtcattcaagcaaaaaacattagtggtcaagcacaagctagt
attgtagttaatgttcttgataaacctgggcaatgtcaaaatctgaagataagttacgta
actaaggattcgtgtatggtatcatgggagaatccagaagataatggaggcacagaaatt
acaaattacattattgagtgtcgacaaccaaatcaaaggggttggacagtagtgtcctcg
gattgcacaaaacgtcttgttaaagcactgctcatggaaaactgtgagtattttttccgt
gtcagtgcagaaaataaatgtggtcaagggccaccaattgaaactaaaatggcaattctg
gctgttgatccaattgaaaagcctggtgagcctgaaaactttcatcctgctgaaattggc
aagacatttgttttccttaaatggaaaaaaccagagtacactggtggaagccacaatctt
gtttaccatgttgaaaggaagctaaaaggagctgaagaatgggaaagactacacaaaggt
gcaatcaaggaaacattctttatggtagataggtgcattgaaaaccaaatatatcaattc
agagtacaaactaagaatgaaggaggagtgagtaattgggtaacaactgctgaaacacct
gctaaagaagaactacttgaaccagaacttggcattaaattagatggtgtcctcaccgtt
aaagctggaaatcctattaaaattgaagcaagtcttaaaggaaagccccaacctgtggtt
aaatggctcaaggaaagtgatactggtgatattaacaaaagcccaagatgtcatactgaa
actggttcagatttctcaaagttactgatgacatcatctaggcgtactgacagtggaaaa
tatgtaggcactgccacaaactgttcaggaagctgttctgctcacattattgtgaatgtg
cttgataaacctggtcctgtccgagacctgaagatatctgatatttcagtggaccgatgt
aaattaatatgggatcctccagaggatgatggaggttgtgagattcagaactacattctg
gaaaaatgtgagacgaggagaatggtttggtcagttcactctgcagctgtgataagtaat
tcagctaatgtgactcgtcttgtggaaggacaggagtatatcttcagaatacgagcagag
aataagatgggaacaggtcctgcagtggagagccaagcagtcattgccagaacacagttc
aatagacctggtccaccagatccacctgaagtcaccaaaattggaaaggaagaaatgaca
gtttcatggcgtcctccaggaaaagatggtggaaagcctgtcacaggttatattctggaa
agaaaggaactacattccattaagtgggttccagttacaaaagatcctatcccacagaca
tgcatgaatgttaccaacttgatccctaaccatgaatatcagtttcgtgtcaaagcacaa
aatgaagttggattgggagatcccagtaaaccctcaatatcagtaactgctagagatcca
gttggacctcctggccctcctgaagatttgaaggttgctgacagcacacagacatccatc
acactctgctggcaaaggccagtttgtgatggtggtgctccaatcattggatatgtagtt
gagtttagaattaagggtgcaagtaaaagcgcagatgaaggctggaaaagatgtaatgtt
gctgctcgactggcagtgacagactttactgttactagtctggatgaaaaactggagtat
gaattccgtgtgtattcacagaaccaggttggcatgagtcaaccagccaatctcaaagat
gctgtgtcgcccaaagagatcctagaggcaccagatattgaattggatgctaatctgaga
aagggtcttactgttcgtgctggatgccccataagattgtgtgccacagttagaggaaga
ccagcaccaaaggtgacatggaggagaatgggtatagacaatgttgtaagaaaaggtcag
gtggatttaatagatactatggcattcctggtcatccctgagagcacacgggatgattcg
ggaaaatattctcttactctaaccagccctgcgggagagaaagctgtttttgtgaatgtt
caagtgctggacacccctggacctgtacaaggtctggaagccaatgatatcacaatggta
tcctgcaatctctcttggtctccccctgaaaatgatggtggaagcgaaattactcactac
atagttgaaaaacgtgaaattgacagaaagacctgggcaacagtcaacaacgatgtgaaa
aagacaaacctgaaaataacaaatcttatatcaggaacagaatattatttcagagtgaca
gcagttaatgaatatggagctggagtgccaaagatttctccaaaatcctacctagcatca
aatcccataagtaaaccagacccaccattaaagattgatgtattggaaattacaaagaat
agcacaactctggcatgggtgaaaccactgagagatgggggagctaaaattgatgggtat
gtagttgattacatgttggtgattccacctcaagaaatcaaagatggacaacttgtggtc
caagagcaaattaaaccagaggaacaatggatgccatattctattgtgaaagacctgagt
attgctgttgttggactcaaagaaaacatgaaatacaaattcagagtgtcagcaagaaat
gtaatgggttgcagtctacccacagaaaccaaaggagaagttgagatcaaggagcaaatg
ttgccaccaaagattattatggttgatactgtgactgcaaaggcaggagaaaaactcagg
gtggaagctcttgtttctggaaaaccaacaccggtatgtaaatggaacagaaatgaagag
gaggtcatcccttctagtcgtctaactgtgcacaaatctcagaacagttgtgtgctcatt
atcaaagatgtatcaagactggacagtggtcagtacagcctttcagctgagaacagtatt
ggacaagtggagcagagtttgaaaattatcatcaaggatatccctggtcccccagaacca
ccatttctaatcagtgatatcaatgctgatacttgcaccctatcttggcaatcaccactt
gaggatggtggtagtactatcactaactatgtggtggaaaaatgtgacatgagcagaaat
gattgggtcattgctgtatcatcatgcactaagactacttgcacagtagggaagcttatt
cctgggaaggagtatatattccgtgttcgagctgagaaccgttttggccttggagagcct
attgtttctgagcggatgattgccaaattcccctttgatttaccaagtgaacctttgaat
tgtcatatcttaaaagtcaataaagactgcatgtttgttgcctgggagaaaccagccaat
gatggtggcagtccaataactggatactacattgaacgtaaagaaaggaacagccttctt
tgggtaaaggctaatgacacagttgttcgcacaactgaatatccttgcagcggacttatt
gaaggtttggaatataccttcagggtatcagccattaatcgtgctggacaaggaaaacca
agcaaaaatactgaatttgctacagcaagaacaccagttgatccaccaagcaagcctgaa
gtgcttgatgtgactaagaattcagttacgctgttatggaacagaccaaaacatgacggt
ggcagtaagatcattggatattacattgaagctctaaagattcctgaagacaaatgggtg
cgctacaacataatcagccaaaatttacccaaagaagaatacactgtaacagggctggag
gaaggcagaaaataccagttcagaatacttgcaaaaactgcagtgaacatcagcagacca
tctgaaatgtctgatccagttctaatatcttctgaaaatgtggcaccaactatagaaatt
gggcttcaaatgaaggcactgcaaccggttaaagctggcaaaaatgtgtgtcttgaagct
caagtatttggaaagccaatgccaaaaattacctggaagaggaatggagagatactgaaa
ccttctgaagtcttgaagatgtcacagaaaagaaatctgttcttcctagagctattatcg
gtaacaagaaatgagactggagagtacactattttggcagaaaatgcaagtggttctaaa
tcaggtgaaattaaactcacagttttagatgtacctggcccaccagtttctgtcaagttt
ggagatgtgtatgcggatcacatcaggctgagctgggagccacccattacagatggtggc
tctgcagttaccaactacattgttgataaacgtgaaacaagcagagcaaactgggctcaa
gtcacatccaaaatcagtgctcagcagactgactattctgtagaaaaactgattgagggt
catgagtaccagttccgtattcatgctgagaacaaatacggtgtgggtgatcctaccctg
acaaaccccattgttgctaagaacccatttgatgtccctggtgcttgtgatcctccaatt
attacaaacataacaaaggatcatatgactgtgagttggaaagaacctgcaagtgatggt
gggtccactatccttggttacatggttgaaaagcaggaaaccaaagatgtaaagtgggat
aaagtcaacagaaaaccaataacagagagatctattgaagctactggtctttcagaagga
aacgaatataaattcagagttattgctcttaataaagctggccttggcaaaccaagtgat
ccatccaaagccgctattgctcaggatcctttatatcctccaggaccaccaatctcgcca
aaagttgttgacacaactaattgcactgtcagtttatgctggacagaaccagctaataat
ggtggatgtgaaatattaggctacctcgtagaaagcaagagagccgatgctgctgactgg
acacggtgcaatgtaccaaggaaccttcaagagacaaattacattgttactggacttact
gagaatactgaatacatgtttcgtgtcacagctgtgaacaaggttggatttggtgaacca
agtgaagttccaggcaaatatactgccaaggacattttggttcctcccgaagcagaactt
gatgaagagctaaagaaaactgtagagttgcgtgctggaaccccaatgaggttgtacatt
ctactacggggtcgtcctgttcccaaggcaacatgggccaagatgaataccaatattaaa
gatagaccaggaattgtgattaagacaacacaatttgatactcttgtttatattgagaaa
gtgaacagatatgatgcaggaaaatatattctgaatctggaaaacagcagtggagtgaaa
atgtacacaattactgtaaaggtttttgatacccctggaccaccgcttaatctaatggta
aaggaaacatcaaagaatagtgcttcacttctttgggatgctccgttaatagatggagga
agcccagtaaagaattacataattgaaaaacgtgatgccgaacgaaagtcttggtctaca
gttgcatatgactgcaccaaaacatcttttctgattcaagacttggagccaggaagatct
tattttttcagagtattagctgaaaatgaatatggagttggggagccatgtgaaattacg
gatgctgtaagagcttcagaacaaccaggaccagttttggacttcaaggcgttactggtg
acaaaaaattcatgtacacttgcttggaagaaaccaattagtgatggaggaagtcgtata
atagcatatgtgttggaagtgaaaaatggaaaagatacttggaagaacctcatgaagtca
aagaatatgcagtacagtgccaaagaccttatagaaggaaaggagtatacttatagagtg
agagcagtaaatgatgctggagatggtgttgcagaggaacttaatgttctggctaaagac
cacacagttctacctggatgtgacttaagagacttgccaaatttatgctatactgctaaa
gagggaagtactgttcgcctgaaaatacccataagtggcaaacctgctcctactgtaaca
tggaaaaaaggtgaagatgttactttaactgatagtggccgagtatctgttgaatccaca
gctgtccacacaaccttgctgattcatgactgccaaagaggtgatgcctcaaaatacaca
ataactctaagaaatagtgctggcaccaaagaatctgccatatttctgaaagtggttgga
aaaccaggaatacccacaggaccaatcaagtttgatgaaatcacagctgaaggaatctcc
ttaaaatggggtactccaaaggatgacggaggatcagaaataaccaattacattcttgaa
aagagggattcagtaaccaatatgtgggttacctgttcttctactgtgcagacaaacagt
ttaagagtaactggtcttcatgaaggaactgaatacacatttagagtttctgcagaaaac
aagtatggaattggagaaagcctcaaatctgattctgttgtggccaagcatccattcaat
gtaccggatgcaccaccaccaccccaaatcatgagtgtccactatgattcagcacaattg
gcatggtctgatccaaggaagactggaggttcccctgttacaggatatcatgttgaatat
aaggaaagaaacagcttgctgtggaagagagccaacagtgctccagtgaaaatgaaggaa
tataaagtaacagatttaacagaaggccttgagtatcaattcaggatcatggctataaat
ttggcaggtgttggaaagcccagtctgccatcagagccagtggttgccttagatcagatt
gatcctcctggcaaaccagatgtggtcagcattacacacaatagcgtaacacttcaatgg
actgaacccaagtatgatggtggacacaaactgacaggctacattattgaaaaacgtgac
ttgccctcaaaagtctggatgaaggccaacagtactaatgttttggattgtgcatttacc
ataactggtcttcaagagggatgcaagtttgaatttagagtaagagctaagaatgcagct
ggggccataagtcctccatcagagcagactgatacaattgtctgcaaagatgaatacgag
gcaccaaacataattattgatccaacagtgaaagagggacttacacttagagctggcgat
acaattgtaataactgcaacaagcataaccggaaaacctcctccgacatcccggtggtct
aaagcgggaagagacctcaaaccatcagacttatgccaaattgaatctaccccaacgtct
tcaacattatcaaaaaagtgtgccaccggaaaagattctggagaatacactatctcagcc
agcaatccatttggtgttagagaggaaaatgttaaagtgacagttctggatgttccaggt
ccacctgggccccttatagccagcaatgtttctgctgagaaggttacattaacatggtca
ccaccccatgatgatggggggtctgcaattaaatcatacactctagaaaaaagggaaaca
agtcgccttctgtggacaattttggcagaaaatgtaacagattgtcatttagttaccagc
aaactaatccaaggcaatgaatacatctttcgggtttcagcattaaaccattatggcgtt
ggagaatcaacacagtctgagccagtgaaaatggaggacagctttggtccgcctggtcct
ccatccaaaccagacattgaaaatgtcaacaaaaactcagttaccatttcttggaagaga
ccagttgaagatggaggcagtaacatttttgggtataatgttgaaagaaaagaaagagat
gggatgcgatggattcgagcatcaaagaaattgatttctgatttaaattttgaagttgtt
gggctcacagaaggaaatgaatatgaattcagagtgactgcagaaaataaagctggtttt
ggagaacccagtgagccttcacaacctgtgatgactaagagtctagcatatgtacctggg
cctccatccaacccaagaattactgatataactaaatctacagctaccttcaactgggga
cggccaaaatatgatggtggacttgacatcactggatatatagttgagcacaaaagagaa
gacgagaatagctggattaaagacacaacaggcagtgcgctaagaatttctgaatttgtt
atttcaaacctgcaacaaggagaaaaatacaattttagagtgagtgcaatgaatgagatg
ggtattggagaaccagctcaagttgcggaatctgttgaaattgtggaacgtcaagaaact
cctgactttgagcttgacgccgaactgaggcgaactcttgttgtcagagctggaggatcc
atacggatttttgttccaatcaaagggcgcccaacacctgaggtgacctggttgaaagaa
gatatatcccttaagggtcatgcaaatattgataccacggaatcatatactctgctggtt
atatcccattgtacaaaacatgacactggaaaatataacttaaccctagagagtgttgct
gggaaaaagtctggatatgtaaatgtacgagtcttggattcaccaggccctcccatcaac
ctgagacctcgggagattactaatgaaggtgtcactctccagtgggaaatgcctctcatt
gatggtggttcaaagataatcaattatataattgaaaagcgggaagctacacgaaaatca
tatgcagctgtaataactaactgtcagaaatgttcagttagagttccaaatttggctgaa
ggatcagaatatttcttcagagtacgtgctgaaaatgaatttggaattggagagcctgct
gaaacttctgatgcaattcgggtgtctcaagcacccactgctcctgagaaggttaacatt
gtagccattactaggaattctgcaagtctcatttggacaaaaccgaaacatgatggtgga
agtagaattactggatatgtaatagaagctcaaaagaaaggctcagagaattggtctcat
gtcacaacagcgaagactctagactatacagtgaaaaatttaaatgaaaatgatgagtat
atatttcaagtaatggctgtgaacaactcaggtagaagtgacccttgtcaaagcagtcct
gttattattaaggaacaaacaaaaggaccacagtttgatctacgtggaatatgtcaaaaa
cttgttattgccaaggcaggagatgatataaaaattgagatacctgttctgggatgtcca
cagcccacaatttcctggatgaaggaggacaaggcccttaatcagacacagagagtatac
attgaaaatactcctatgtcaactctcctttgtattagtgaatgtacaaggaatgacagt
ggacagtatgctgtgacaggaaaaaatatacttggcacactgacagaaataatcactgtt
aaagtacatgacatccctgggcctccaaaggggccaattcattatgacagaatttccaat
gaaagtattacaatatcttgggatccccctgaaaatgatgggggagtgccaattaacaat
tatattgttgaatttcgagacacaacaagtacatcatggtcggtgttatcaacaacaata
atccgtacagttttcaaagctgaacgtcttacccctagagctgagtatcaatttcgtgtt
aaagctaaaaacagatatggtgttggccctccaataacctccgaatcagttgttgctgca
tacccatttaaggttccagggcctcctggcactccacaagtaataggtttcactaaagat
accatgacaattagttggaatgaacctgtgaatgatggtggaagtgaagtgattggatac
catattgaaaggaaagagaggaatagtatcttgtggcaaaaagtaagcagtgccctaata
gttggaaacattttcaaatcaatagggctagaagctggaatcgcctatgagttccgtgtt
gcagctgaaaatatagctggtgtgggaaagccaagcaaaccatcagagccttctcttgcc
cttgatcccgtggatcctccaggaacgccagttgccattaacatttctaagaattttgtg
aatattaagtggacaaagcctaattatgatggtggattcaaaataactggctatacagtg
gaaaagaaagacttaccaaatggacgctggatcaaagttaattatagtaacatacaagag
actacatttactgttagtgggctgacagaaggtgcctcctacgaattccgcgttcttgcc
cgaaattcagctggtgctgtaagtagcccatctgaaccatcagatccaattgtctgtaaa
gatgacgttgaggaaccaaagattagggttgatgctaggtttaaagatgttttacttgta
aaagctggggaagtgttcaaacttgaggctgatattacaggtcacccattaccatctatg
atttggactatggatggaaaggaaatagaaaaaacaacaaaactagaaataaaaatggct
gatttttcaacaatattgattaacaaagattctacaagaagagatggaggtgcatttaca
ttaactgcaagcaatactggtggatttgcaaaacatgtcttcaatgtgaaagtgcttgac
aggccaggtccaccagacggtccattacttgttacttgcattacagctgagaactgtgtg
ttgtcttggttgccaccatcaaatgatggtggagcaaatattgaatattacataattgag
aagcgtgaaaccagcaggcttgcctggacaaatgtggcttcagacttacaagtaaaccag
tttaaagtaacaaagctattaaagggaaatgagtatatcttcagagtgatggcagttaat
aagtatgggattggtgagcccttagaatctgagcaaattattgcaacaaacccatatatg
ccttctgatcctcctcaaaatcctgaagtaagaaatatcactaaggactcaatggtaatt
tattgggaagagccagtgaacaacggtggagctgaaatttctggttacattgttgaaagg
cgagataagacaagtctgcactggattagatgtaacaagaaggttattactgatttaaga
tacaaagtgtcaggactgacaccagggcatgaatatgaattcagaattactgcagaaaat
gctgcaggtttaagtttgccaagtgcctcaactccattttgcaaggctagtgacccactt
tacaagccgggtcctcctggaaatccaagggttttagatacaactaactcatcgattacc
gtcgcatggaacaagccagtttatgatggtggatctgacattacaggatacattgttgag
acttgccttccccaggatgatgaatggacagatgtcacccccaaagatggtatagtgacc
acattatttacaatcactaacttaaaaggaaatcaagaatataaaataaatatttttgcc
gttaactgtgaaggagttggagagccagcctctgtccctggattaccaaaaacagaagag
agacagattccacctgatatcgaacttgatgcagagcttcgcaaagttgttaccatcaga
gcctgtggcacattgagattgtttgtacctataaaaggaagacctgctcctgaagtgaaa
tggtcaagagaaaatggagagtcaattgaaagagctacaattgaaagtacatcatcattc
acttggctattaattgaaaatgtaaatagatttgatagtggaaagtatgttttatcagta
gaaaatagttcggggctaaagacagcttttgtgaatgtaagggtactggatactcctgga
gcaccacaaaatatcaagatcgatgaaataaccaaagaatcagtttcactcagttgggac
cctcctattcttgatggtggaagtacgattaagaactacattgtagagaaacgtgaatca
acaagaaaagcatatgcaactgtaaatgctaactgccacaaaacaagatcgactgttaat
aatttacttgaaggatgcaattattattttagggtgttagctgaaaacgaatatggagtt
gggcttcccattgaaactagagaatcagtcaaagtgtctgaaaaaccacttcctccaggt
aaaatcacattgcaagatgtgacaaagaatagtgttacactgtcatgggaaaagccagag
catgatggaggaagcagaataattgcatatgttgtggagatgcagagcaaaggcagtgat
acctggaaccaatgcatgattgtaaaagtcacagaagctattattactggattaacacaa
ggtgaagaatatatgtttcgagtatcagcaagaaatgaaaaaggaacaagcgatccacga
caaattggtgtaccagttattgttaaagaacttgtaattactccagcagtaaaactgttg
ttctccacatttagtgcgctggcaggagaagacttaaagatagagatatcatatgtttcc
cgacccaaagcagctatgtcttggtacaaagatggtgttcctgtcaagcaaacctcaaga
attaattttgaaatggctgacacccatttgtatttaaatatcaaggaagtctgcagaggt
gatgttggtcggtatactgtcaaactttcaaacactgtgggtgaaacgactgcagaaatt
tgtgttgttgttctcgacaaacctgggccaccagctggtccagtaaatgtagctgaagtt
acagctaatagtattacattgtcttggaaacccccagaatatgatggtggctgtactatt
aagaactacattgtagaaaagagagatgcttccactacagactggcaggttgtggcaaca
aatttaccaagaaccacaattaaggcaggacgactaaaaactggatctgaatatcagttc
aggattactgctgaaaaccgatatggaaagagtccagttctagtatcagataccgtagtt
gccaagtatccctttaaagttccaggaccccctggaactccatatgtgcgcgctgccaca
aaagataatatggatgtaatttggaatgaacctgtaattgatggaggaagccaaatatta
ggataccacattgaacgcaaagaaagaaacagtattctctggataaagctaaataagaca
cttattcgagacacacagttcaaaagtgtaggtcttgaagagggaattgaatatgaatac
agagtttatgcggagaatattgtgggaattggtaaagtaagcaaactatctgaatgttat
gtagcaagagatccttgtgatcctccaggaacccccgaagttgttactgtcacaaaaaaa
tcagtttttcttagatgggcaaagccagagtatgatggtggaagcaaagttgctggctac
attgtggaaaagaaagaattacctgaaggacgctgggcaagaaccaactttactaatgtt
actgagactgagtatgtggcaactggcttaacagagaatcaacagtatgagttccgtatc
attgcaagaaatgcagcaggtatcttcagtagtccctcactcagcactggtcctataact
gcaaaggatgaagttgaaccacctagaattagcatagatccacgatatacccagactatt
ataataaattctggggagaacttcaaaattgatgcggatatttttggaaaaccaatgcca
acaattagctggatgaagggaaaacaaattctttcaaatactaaacactgtaaaataaaa
agtactcaatacagtacatgtctcagtgtaaaggaagccacatcaaatgattcaggccag
tatagattgcttttgaaaaatattggaggagagaagtcagttctggtcactatcaaagtg
ttagatagaccaagtccacctgagggtcctatttctgtcagcaatttgacaaaagagcaa
tgtttaattagctggaaacctccaaaggaagatggtggtgatgaaatatctcactacatc
attgaaaaaagagaaacaagtagattggtttggactgttgttgaacctgaaacaaaggaa
cttaatttgaaaataactaaacttttggaaggaaatgagtatatctttcgtgtttcagca
gcaaacaaatatggagttagtgagccattagaatctgaagctattattgcaaaaaatctg
tttgtgagccctgatgctcctaagggtgtggaagttgtcagtatcacaaaagattcaatg
gtggtaatttggtcagcacctgacaatgatggtggtagttctattacaggatatgttatt
gaaaagcacgacaaagaagggataagatggactaaatgcaataagcacacagtaactgaa
ctatcctttaaagttaaagggctttttgaaggccataattatgaatttagagtttcagcc
gagaatgatgctggagttggaaaatcaagctccccttctatttattacatggccatcgat
cctgtattcagaccaggtcccccaaatagtcccaaagtgactaacatttcacggacatct
gttttcctttcctgggagaagccgatttatgatggtggctgtgatattcagggatatatt
attgaagcatgtgaagcaacatctgaagaatggaaaatgtgtactcttcccacaggcata
aaacaaacacaatatgaagttgaaaaacttaaagaaaaccaaaattataaattcagagtg
tttgctattaataaggtcggtgttggagagcatacagatttccctggcacaatccttgtt
gaagacaagacacaagaaccagatcttgatattgaaatggaactcaggaaaacaatcaat
attaaagctggagattccttgagagtgttcatacctatcagaggacgaccagctcctgaa
atcagatgggaaaaagttgatggtaaaattaaagatacagctcagatagagatgacaagc
agttgtacctcccttgtcattgataacgttaacagatttgatagtgggaagtacactgtt
acagctgaaaatgtttgtggtgtaaagactgctaccatcagtgtcaaagtacttgacaca
ccaagtgcaccattaaaccttaaagtaaaagaaattactaaggagtctgtaacacttatg
tgggaacctccagcattggatggtggtgcaaaaataaaaaactatattattgagaaacgc
gaaagcacaagaaaggcttatgcggctgttgtcaccaattgtcacagaactacctggaag
attgaaccacttcaagaggggtgcaattattattttagagtgcatgctgagaatgaatat
ggtattggattacctgcagagactgttgattctgtaaaagtatcagaggtacctcaagtg
cctaagaaatttactgttgttgatgtcacttgcaaaagtgtttctctggcatgggaaaag
cctgatcatgatggtggcagcaaaattgtacaatatcttgtggaaatgcaagtcaaaggc
aatgaaaaatggtctgggtgtgcaactgtgaaaacactggacactgttgtcagtaattta
gttcagggagaagaatatatgttcagagttattgctatcaatgaaaaaggaaaaagtgac
ccaacatctcttgctgtcccagtgcaggctaaggaccttgttattgatccagatgtaagg
cctgcatatagcaattatagtgtactaattggaaaggacctcaaagttgaaataccaatt
tttggacgtccaaaaccaaaaattatttggactaaggctgggttagctcttaaagaaaca
acaagagttaatgttatcaatacagcacaccacacaactcttaacataaaagaaacaaca
aaagatgatggcgggatatatggaattactgtttctaatgttgttgggcagaaagatgca
actatactaattattactctggataagccagacccaccagctgggcctgttagatttgat
gagatcagttcacaaagtgttacaatttcctgggatccaccaaaatatgtcggtggctgc
catatttcaaactacattgtgaaaaagcgggacataaccactactgattgggagaatgtg
tcaacgaccgtaccaaggaccaccctgaaagttaccagattaaagactggggcagaatat
caatttagaatcattgctgaaaatcggtatggtaaaagtcacgcattggactctgcatct
gtgactgtccagtatcctttcaaagtacctggtccacctgggactccatttgtctcctca
ttatcaaggaatcacatgattgtggagtggcatgaaccaattacagatggaggtactagc
attataggctaccatcttgaaagaaaagagagaaatagcattctgtggacaaaaattaat
aagacactaattcaagacacttatttcaaaacaagtcctctagatgaaggtgttgagtac
gagttcagagtttttgctgagaatgttgtaggcataggcagatgcagtaaaatttctgag
ggatatgtagcatgtgacccatgtgatcctcctgggaccccagagcctattattgtgaat
aagaatgcaatcacaattcagtgggcaaaaccagagtatgatggaggcagcattattact
ggctacatagtggagaagcgcgatttaccagatggacgctggatgaaggctaactttaca
aatgtaactgaaactcaatttacagtatctggactaactgaagactccaagtatgatttc
agagtaattgcaaagaatgctgctggtactattagtaaaccatcttataacacagggcct
atcacagcaagggatgaagttgagcctccaagactttcacttgatccagaatacagtcaa
gctgttgttgtcagtgcaggaagtacatttaagcttgatgccgatgtctatggaaagccc
acaccaacagtccagtggttcaaggaggacaaggggattgaaaatacgctgagatgtgag
atcaaaagaacggaccttagaacaatacttactgttaaagatgctatcaaaacagacagt
ggtcactataatttgcaggtcgctaatgtagctggtaccaaaatttttacattttatgta
aaagtattagacagccctggaccttgtggagggatgctaaatgtatctgctgtgacttct
gaaacatgtacattgtcttggcttcctccagaacatgatggaaacagcaatatttctcac
tacatcattgaaaggagggagacaagccgccttgcatggactgtagttgctagtaaatgt
gatgtcacatcatttaaagtaaacaatcttctggaaggaaatgaatatatatttcgtgtt
atggctgtaaatagctatggtgttggtgagccgctagaatcatcacctgtgacaatcaag
aatccatttttactacctggatcaccacaatctgtagaagtaactaatatagcaaaagat
tctatgactgttttctggagtagtccggaatctgatggtggaagtgaaattactggatac
atcatagagaagaaagataagactggaatcaggtggacaaaatgtaatcgacaaactatc
acagatttatctttcagagtgacaggattgaccgaagatcatgaatatgagtttagaatt
tctgctgaaaacatggcaggacttggagaaccaagtttaccaacatcatactataaagcc
tgcaatccaaaattcaagcctggtccaccaacccatgtccatgtgactgacactacaaag
aactcagtttcattagcatgggggaaaccaatttatgatggtggatgtgttattcaggga
tacattgtggagatctgcaaagctgatgaagaggaatggataatgtgcacaccagcaact
ggccttccctttaataaacttgatatcacaaagcttacagaaaataaagaatacaaaatt
caggtttgtgctattaacaaactaggtattggtgaaccggctgctattcctggaactgtt
aaagtgcaggacaaaatagagcccccaggacttacaattgactctgaactgaggaaagga
attatagtgcgtgctggagagtcaataaaaataaatataccattcagaggaagacccact
cccaagattaactggacaaaggatgaaaaagaattgacagataaggtccacattgagaag
cggcttgattatacccaactctcaattgataaatgtgacagaaatgacactggaaaatac
actttgacactggaaaatagcagtggcattatatcagaacttgtgtctgtgaaagtactg
gatacaccgggagcaccaatgaatttggctgtgaaagatatcaagaaagattccgtcgtt
cttgaatgggaaccaccgcttattgatggaggagcgaaaataaaacattttattgttgaa
aagcgtgaatcaacaaggagggtatatgtcaatgtcactgctaagtgtgacaaaacgttt
tgtaaagtagataatctcactgaaggagccatgtattactttagagttatggctgaaaat
gaaaatggaattagtcatccagttgaaacaaaaaatccagttaaagtgtctgaggcccca
ctttcagtaggaaaagtcattttgacaaatgtaactaaagtttctgcttctttagcatgg
gaaaaacctgaacatgatggaggtagcaggatcataggctatctaattgaaatgcaacca
aaaggatcagacaagtggagtgtagcagcatcaactaaaacatgtgaaggtactgttgaa
ggattagtatttagtcaggaatacttctttcgtgttttagcctacaatgagaaaggaaag
agcattcctgtgcttttagctgctccagttatcgccaaggatttgagtactgaacccatg
ttgaaattaatgttcaatacctacagcatccggtctggagatgatcttgcaatagaattg
catattattggatgccccaaacctaaaattatgtggatgaaagatggacaatcactaaaa
cagacatcaagggtaagtgtcttaaacacacctaacactacaacccttaaaataaaggag
gctaacaaagatgatttgggaaagtacacagttacagcaacaaatgatgctggtattgca
acagaagaaattgggatcattatacttgataagcctggtccaccaacaggacccattaat
atcaatgatgttagtaataattctgtcacaatatcatgggaacctccagtgtacacaggt
ggttgtcaaattaaaaattacattgttgaaaaacgggacgcgactaccacagtctggcaa
gttgtatcagcaaatgtatcaagaacaactatgaaaattactaaacttgcaacaggttca
gaattccaatttagagtttctgcagagaacagatatggaaagggttcttcattggactca
aaagcaattgttgtacagtatccttacaagcccccagggccacctggtactccatttgtc
acatcagtgacaaaggatgacatggttgttcaatggaatgaaccagttaatgatggtggg
agtagagtcaccggctatcaccttgaatgtaaagaaagaaacagcattctctggactaaa
ttgaacaaaatcttaattgttgatacaatcttcaaagttaacaatcttgaaaaaggcggt
ggatatgaatacagagtttttgctgaaaatattgttggtatcggtagatcaagtaaggtt
tctgaatgctttgtggctcttgatccatgtgatccaccgggaacacctgagccaatattc
atctcaaaaaatcaagtgacacttcagtggacaaagccacaatatgatggtggcagcaaa
gtgactggctatgctgtagaaaagaaagatttacctgaaggtcgctggatgaaggccagc
tttacaaatatcattgagactgagttctctatgacaggattaacagaaaatgaaaaatat
gaatttagaataattgcaaaaaatgcagctggtaatttcagtgagccctctgacagcagt
ggaccgattactattaccgatgaaatcgaatccccaagagcatcaatggatccaaaatac
atggatattatttttattaatgctggggaaactcttgttattgaggctgacatctatgga
aaaccagcacctgaagttttatggaaaaaagatggaaataaaatagataagactactcga
agaaatgacataaagcatgcaataaaaaacacatcactcacagttaaggactgtatcaga
gaggacagtggtaattataccctcactctaagtaatgctggtggaataaaaacaatacct
atcacagttaagattcttgatagacctggaccaccagaaggtgttctcaaggtgactgat
gtaactgcagattcatgtctcctgtcatggaatgatcctttacaagatggtggtgcaagt
gttattcattacattattgagaagagggatactagtaggttgtcatggactatagctgaa
tcagatattcaagcatttagttataaagtgactaatcttttggctggtaatgaatatgtc
ttccgaattaaggcagttaacaaatatggagtaggtgacccccttgagtctgaaccagta
acagcctgcaatcccttcaaaccacccagtgcaccatccatacctgaagcaactgctata
acaaaggattctatggttattaaatggaatcaaccagagaataatggtggatcagaaatt
tacggataccatcttgagaaacgggacaaagatggtgttagatggacaaaatgtaataga
agtaaactcagtgacttacatttcaaagtaaatggactcacggaaggacatttttatgag
ttcagagtctctgctgaaaatgaggctggtgtgggacagttaagtgaaccatcaatgttc
tacagggcatgtaatgctgcatgtccacctggtccaccaacgcatccaaaagtgactgac
cacacaagcacaactgtgtccctagcttggagcaaacctgatgatgatggtggtgcatac
attaagggatacctcgttgaaatgaaggaggctactcagggagaatggactatctgtaca
ccttcaactggcatacaagcaacaaagtttactgtaggtaaactaaaggaaaatgatgaa
tacaacttccgtatctgtgcatttaatgctgaaggtgttggagaacatgctgatatccat
ggctgtgttgctgctgttgaaaagcatgaagccccagagattgaacttgatgcagacctc
agaaaagtagtttctatacatgcaagtggaacacttcgcctttttgtcacaattagagga
agacctgaacctaaagtcaaatgggaaagagcagaaggattgctgactgaacgagcacaa
attgaaaccacaagttcgtacactatgcttgtaattgacaatgtaaacagatttgacagt
ggtagatacatcttaagtcttgaaaataaaagtggcacaaagtcagcatttgtcaatgtc
agagtactcgactccccaagtgaacctcttaaatttgaaatgaaagatataatgagaaat
tcagtaaccatctcatgggagcctcctctcagtgatggaggagctaagataacaaattat
attgtagagaaacgcgaatcttcaagaatggcctacactactgttacaagtaactgcact
aggaattcattcaaagttgatgagttgcaagagggatgtctttactacttccgtgtatta
gctgtcaatgaacatggtgtaggtttggctgcagaaactaaagacccagttaagattgct
gaagtacctatgccacctagtaaagtttcactgtttgatgtaacgcgcaacagtgtaatt
ctctcttggaagaaacctgatcatgatggtggtagcaaaattttatgctacaatgtagaa
atgcaaactaagggtagtgaaaaatggactgtaagcactactgttaaggtgttggaagca
acaataactggtcttgtatcaggtgaagagtactctttccgggtcattgctttgaatgag
aaaggaaagagcaatcccaaagaattaggtgttcctgtgattgcaaaggacatggaaact
gaacctactattgatttgatcttcaacacatatagtgtgaaagctggaaaggatctcgca
attgaaattccgtttaaaggtaggcctaagcccatcgtttcatggaaaaaggatggtctt
cctctaaagcagacaacttcactgacaattctcacttctgtaacatctgcaaaactttta
ttcaaggaagctaccagagagcatgtcggaaaatatgacctcactgtagctaatgccgct
ggcactaagacagctgaaattgctgtctttgtccttgataagcctggtccaccagctgca
attagaatagatgatgtaagtgctgaaagtatatcattatcttgggacccacccgcatat
gatggtggatgtcacatcagcaactacattgtagaaaagagagacactaacacaaatgaa
tggcaaattgtttcatcaacagttgcaagaacatctatcaaaatatctcaattaattaat
ggttctgaataccagttccgtgtttatgctgtgaaccgttatggaaggagccattccata
gattcttcaagcattactgcacagtatccatttaggcagcctggacccccttctacacca
caggttgccctagcaagtaaaacttttatgctggtcaaatggaatgaaccagtgaatgat
ggtggtagtggagtccttggatatcacatagaagtcaaagaaagaagtagcattctctgg
acaaagttgaacagaagtctcatcagggatacggaatttagagttactagcatagaagag
ggtttgttttatgaatatcgtctttatgctgaaaatattgctggcattggcaaatgtagt
aaagtctcagaacctgtggctgcaagagatccatgtgatcctccaggtcaacctacagtt
acaaatataactagaacatctgtttcactgtcttggacaaaaccagaatatgatggtggg
gcaaaagttacgggatacataattgaacgcaaggaagaggaacgatggctgaggtgcaat
ttcactaatgtccaggaaacatactttgttgttacaggccttaccgaaaaccagaaatat
gattttcgtgttattgctaaaaatgctgctggattatttagtgagccatcaaattgcaca
ggtcctgtaatgattaaagatgatgtagaaccaccacggattatgatagatgccaagttt
aaagatgtagttgctgtgaaagctggtgagatcttgaaaattactgcagatttttctggg
cgccctctcccagttatttcttggacgaaagatggtaaagagattgaggttagagctaaa
gttaatatcgtttcaacagacacttgtacatcagtcattattaaagactgcatcagaagt
gactcaggacagtatgtgttgacattacagaatgtggcaggaattaaatcattccctgtg
aaatgcaaggtgcttgacaggcctggaccatcagcaggaccattagacgtaactgatgta
actgccgaaaaatgtatactggcctggggaccacctcaagaaaaaggaggtgcagaaatt
tcccactacattgttgagaaacgagaaacaagccaccttgcttggactttggtacatgga
gacctgaaagcaactacatgtagagttactaacctacaaaaaggaaatgagtatatcttt
agagttttaggtgtgaacaagtttggaattggtgaagctttagagagtgatccgattaaa
cctacagatccatttagtaccccatctcctcccacacatgttaagattacagatgtaagc
agtgaggcaatgacaatctgctgggaaaaaccagtcacagatggaggcagtgtagtttgt
aactatgtcattgaaaaacgtgagaagtcaggcctgcattgggttcgtgtgaacaaagaa
tgtgtttgtgacctcactttccaaacaaccaaactacataaaggttgccagtatgagttc
cgtgtttatgcagaaaatgctgctggtttaagtctcccaagtgacccaagtccattaact
aacgcagaggacccacaatgtgtgccatccccaccttctaagccaaaagttattgattca
acaaagaattctatcacaataatatggaacaagccactgatggatgggggaagccctgtc
actggatacaacgtggaatataagaaaacagaagaagaagactggatagtggctgctgaa
aatacaaaaaatactgaatatactgttgctggacttacatctggagcagagtatgtgttt
gttgtcaaatctgtaaacaagattggtgtaagtgaccctagcgcacactctgttcctcaa
gttgcaaaggaaagagtggaagagccaacttttcaagttgataaagaaatgcataggaca
ttggttgtgaaacataacacttcatttactctgaaagtacaattcaaaggaaaaccagtt
ccgagcgtaatgtggcaaaaagaagatgtcaatctgaaagatagtgcgaccatctataca
aatgataattctacatcaatcacagtagaaaaagcaacaagaaatgattctggaaagtac
accgtaacactagacaacagtattggcactgctgcattgactctggatgtaaaagttctc
gattctcctgggcctccttcaaaactttccattaaagaggtgactaaagactctctaata
ctgacatgggatgctccagacaatgatggaggtgacccagttaaaaactaccatgtagag
aaacatgaagcaagcaaaaaggcatgggttagtgtcacgaacaactgccaccatctaacc
tatgaagtgaaaaacctgcaagaaggagccttttactacttcagagtcactggagagaat
gaatttggagttggtgtgccatgtgagacaaaggatggaattaaagttacagaaaaaccc
agcacgcccacaaagtttggagtcactgacgtaacaaaggatagtgtttcactagcttgg
aataaaccagagcatgacggaggtagcaggataaccacttatctaattgatgctcttgaa
aaaggacagaaaaagtgggtgaagtgtgctgtggtcaagacaacccactatgttgttcaa
ggtctaaaggaaaatgctgaatatttcttcagagtccgtgctgaaaattatgctggtcta
agtgagccaaaagagttaattacacctgtgattgttaaagataaacttgaatcccctgag
ttcgacctaaagaacttccctcataatactgtatacgtcagagctggatcaaatctcacc
tttgaaatcccccttactggaaagcctctaccaaagcttactatttcaaaagataatgct
gcaatgaaagtaacaaagagatttaactttgaagtaactttcgaaaatgtaatagttaat
cttaaagaaagtattgcaaatgatgctggaaggtacgacatcattgcatccaacaagggg
ggaattactaagacttttgtgaatattttggtcctggatagacctggtactccagttgga
ccagttgaaatcattgatgtctctgaagacagtgtgagtctccagtggcttcccccagtc
tataatggtggtagcccagttaccaactatgtaatattgaaacgtgaaacaagtacttca
gcttggacagaggtgtcatctacagctgcaagaagtgcaatacatataactaagctgacc
aaaggggaggagtatcagttcagaattaaggcagaaaatcgctttggcatcagtgatcat
attgactccaaagctgtgacagtcaaacttccatacaagattcctggacctccttcaact
ccatgggtaacaatggtttcaagggagagtcttactgtctgctggcatgaaccggtctca
gatggagggaaccctgtttttggataccatttacatatgaaagagagaagcagcactgtg
tggcagaaggttaacaaaacacccatccatgccacacagttcagagtgacaaacatttgt
cctggcttgatctacgagttcaaggttgcagcagaaaatgctgccggcattggcaaaatc
agcaaaacctcagaagaagtcctcgcaattgatgcttgtgagcctccagctaatgtgcgc
atctctgacataacaaagagttccgtcactcttgtctggcagaagcctccatatgatggt
ggaagcaaaattacaggatacattgttgagaggagagatgctccaaaaggcagatggaca
aaagctaacttcactaatgtcactgagactaattttaccatatcaggcttgtctacagaa
gagttctatgaattcagagtctttgcaaagaattcactgggttccataagcaatccatct
cttactgcaggaccagtcaaatgtgttgatgcacatggtgctcctgagattgacctaccg
ccagaatatttggatgtcatcaaattcatggctggaaacattgtcaagattcaagttgga
attatttctaagccattaccagtaattgagtggtataaggacggaaaagaattggtatca
agtgctcaactctcaattgaaaacacaacagatgcatctggaattgtcatcaaggatgcc
aatcgtctagacagtggaacatatgaaatcaaaatcaaaaatgttgcaggctctacatca
gcttcaatcagagtacaaattctcgataaacctggacctcctggcagaaccattcagttc
aagacaatcacagctgataagatcaccttcacatgggatcctccagtagacgaaggtggt
gccaaagttacccactatgttgttgaaaaacgtgaaacaagcagagttgcatggtcagta
atatctgaggagttggaggaatgctatatatcagttgaaaagctcatcagaagcaatgag
tacatcttccgtgtccgaggtgtcaataagtatggaattggtgaccctctagaatctgag
ccagttgttgctaaagatgcatttgttgcaccgggacagcccgctatgccatatgtagct
agtattaccaggtcatcaatgacagttgtctgggagaaaccaagcgtggatggtggcagt
gaagtaattggatattgcttggaaaaacgagacaaaaagtgtttacgttggcaaaaagtg
ttcaaagaccctatatgtgctgtgacacaaaaagtacaggatcttatagaaggcaaggaa
tatcaatatcgcgtctgtgccatgaatcaggctggagaaggaccatactctgatgtttct
gatttttacagagctgctgatccaattgatccaccagatgagccaaccaaaattaaagtc
cttgactcaacaaaaacatcaatcacacttggctggggaaagccacaatataatggtggt
agtgagatcactagttatgttattgaaaagagattggctgaggaaaatgaatgggtcatc
attagctccaagggtgaagttagaacaacagagtatgtggtgtcacacttgaaacctgga
attgactacttcttccgtgtaactgctgttaactgtgctggacgtggaaaaccacttgag
atgattgagccagtgcaagctgaagatattcttgcggaagctgaggtagacgttgatgtt
actatgagaactcaatatacagtgaaagctgggactgatgtggaaatcatggttccactc
aaaggcaggcctgccccaagcatcacctggaaaataggagacaaggacataagctgtgat
ccaagatatgacatccgcaacagtgaatcttcaactgtagttttcattcgacaagttact
cgcaatgacacgaacaaatatcgtcttgaatttgaaaatggtgttggaacgccgaagaca
gtaacaatatctgttaaagtacttgccactccatcagcttgccagaaactgacagtaaaa
aaggtcactcgtgggaaagtcacactcagctgggaagcaccccttcttgatggtggtgca
ccagttgctaattacataatagagaagagagactctacaaagcggtcatattcaagtgta
accacaaagtgttccagtacaacatatgatattgaagatctctcagagaaatcactatat
ttcttccgtgtgtcagcagagaatgaacatggagttggtgatctttgtgaaacaacagaa
cctgttagggccactgaaacacctggaccagttaaagatatattaatgaaagattccact
aaagcatcagtagctttacagtggagtaagcctgatcatgacggtggcagcataatatct
gactatgtaattgaaaagagactaaaggatgaagaagaatgggcatttgctggtaccagc
aaaatatgtgaatatgaggtcaaaaatcttaaagaattagcagtgatggagttcagagta
tgctccaagaatgagaaagggcaaagtgacttcactgaatttggacctatcactgttaag
gagtttattattccacctgaggcagacctatcaggttacccaaaaggagaaatccatgtg
cgtattggacataatgtacatattgagttaccatacaaagggaaaccaagaccaggcatg
gagtggctaaaggacaacttaccactgaaagaaagtcaacaggttcggttcaaaagaaca
gctgacaaaattactcttatgattaaaaatttaacaaagcataatgctggaaaatatact
ctagctctcgacaacaaagtgtttaggaagcttttccacataaaagtcattactcttgga
ccaccttcaaagcctactggcccaatacgattggatgaaattagagcagagagcataata
atatcttgggatgaaccaaatgatgatgggggtggagaaatcacttcctacactgtggag
aaatgtgatatttcccaaactgattggaagatggcatgttcaaatgtaactggaacaaca
tttaagatacccaacttgattgcaggagtggcatatcaattcagagtttgtgcagaaaat
agatatggtgtgagtgagcccctcttttcgcaaaatgtgatcgctaaacaccagtacaga
ccaccaggtgccccaggaaagccagtcatttacaatgttacaaatgatggcatgaacatt
cggtgggatgcaccagtttttgatggtggctccccaataatgggcttccatattgaaaag
aaagagaagaacagtattatgtggcagaaagtaaacctaacaataataaaagaaagagat
tacagaattattggcctcattgaaggacttgagtatcaattcagggtctctgcacagaat
gactgtggcatcagtcgagtcagtgaagccagtaagctcactatggctgcatctccagtt
gatccaccaggaactcctgactacagcgatgtaacaagtgaatcggtcacactaaagtgg
gatgctcctaaacatgatggaggcagcaaaattgttgcttatagtgttgagaaacggcaa
ggcaaagatcgctggttgaaatgcaacttcatagatgttgctgagtgccagtttacagtt
actggccttacatgtggagaacgctatgagttcagagtgtttgccagaaatgcaattgga
acaaccagtccaccttcccagtcttctggctatattgtagttagagatgaaagcgttgct
cccaacattgattttggaaaggagtattttgagggtctcacagtcaaagcaggagataat
atcagacttaaggttaatgtcactggacgccctaaacctcatgtcaagtggtttaaggat
ggaaaagaaattgacaggagaatgatgattgatatcacgacaaccaatgggtcaagcatg
ctgttcatccgagatgctgaccgtaaccattgtggaatatatagcgtagaggccaagaat
gcctcaggaagtaaaaaagaggatattcacgtacaagtcttagattcacctggagaacca
gcaggagcaattgtttttacaaatatctcagaggacagcgtaacactctcatggaatcca
cctaaaaatgatggttgttctgctatcactaattacattattgagaaacgtgagacgtca
aaggtttcttggactcttgttgcagaccattgtgaaaactgctcatatacggtctctaag
ttgatcaagggcaatgaatatcaatttcgggtttctgcagtcaacaagtttggtgcgggc
agatcgttggaatctgatcccatcactatacaaatgcaatttgctatcccagaagctcca
ggaacccctgatcctaccagtattactggagatagcataatgctcacttggacaatacca
aaatatgatggtggaaatgaaataaagaattactttctcgaaatacgtgagaaaaagaaa
atgcattggatgaaggttttatcaaaaatacccatcactgagccattgcacaaagtaaca
aatctcactaagggcagtgaatatcaattccgtgtatcagctgtcaatgatgctgggatc
ggatcacctagcaacacatcagaatttataagatgtagtaagccaataagcactcctagt
gctccgactgtcataaatgtaactgattcctcaaagacctctgtcagactagaatggacc
aaacctttgtctgatggtggtatggagatcagtggttatattattgagatgtgtaaagta
agctctggagactggcataaaataaatgctgaaaattgcaccaacactaaatatactgca
actgatttggagcctgatgaagaatataatttccgcgtctgtgcagtaaatggagctgga
aggggagaaacccgtgaaatacttaaaccaacaaaagctctggacagacttgcatcacca
gaaatagacattgatgccagcttcaaacagacacatattgtgaagaagggcaccaccatc
catcttcatgtaggatttaaaggaaatcctgcccctgtgactacatggaagaaagagtta
ggagagtttagtgtaatggcaggtattaatactacagaaaattttagcaccttaacaatt
gacaactgtaacaaatatgattctggaaagtactctctttctcttgaaaacagtagtgga
agcaaatcaattacatttacagtgaaggtgctggatacacctggacccccaggatcaatt
actttgaaagatgttacaagaggagctctgacacttatgtgggatgccccaattaatgat
ggtggatcccgtgtccttcattacattgtagaaaaacgagaagctagtcgtcgtacctgg
caacaagtcagtagcaaatgtgttctacaacatttgagggttaatgatctcttagaaggt
gtgccatactttttcaaggtgtttgctgaaaatcagtatggatcaggtgaagtatatgaa
atgccagatccagttattgccactgcagaaccagctccacctaaacgactggatattact
gatacaacagattcttctgcaacattgacttggttgaaacctgaacatgatggtggaagt
cgcatcacaggctatattgttgaaaccaaaataaagggctctgacaaatgggttattggt
ggtcatgctaaatccttaaccatggtagttgatggtcttacggaaaatgcagaatatgaa
tttcgtgtgaaggctaagaatgatgctggcatcagtgatgcacgagaagcatttagctct
gtgattataaaagaaccctgcattgaaccaactgctgatcttagtggcatcacaaatcag
ctcatcacatgtaagactggaggaactttcaccattgatgttcccattagtggtagaccg
actcctaatgtaatttggaaactagaggagatgagactgaaaaaaacagacagagtctca
ataaagacagtgaagaacaggaccaccttatcagtgaaagactgtatgagaggtgatgga
ggaaaatactaccttaccctcgaaaacattgcaggaaccaagacatttactattacagta
aatgtcatcggaaggcctagtgcaccatgtagaccaattgaagtttcatcaatcacatca
gaatcctgtgtactgtcatgggaagaacctgaagatgatggtggaagtgatatcactaac
tatattgttgaaaagcgtgaatctggctcaagtgcttggcaacttgtgaactccagcgta
aagtacagaacaattaaaatcacccatcttgttaaatacatggagtacacattccgtata
tctactgaaaacagatttggtgtcagcaaacctactgaatctgaaactattgtagctgaa
aatccatttgttcccccaagtgcaccaacacgaccagaagtattctctgttactgcaaac
tgtattagcattcgctgggaagaaccatatcatgatggtggcagtaaggttactgggtac
tggattgagaggaaagaacgcaacaccatcctttgggtgagagacaacaaggtcccatgt
tttgaatgctgctacaaagtaaacaatcttgttgaaggtcttgaataccaattcagagta
tatgcaatgaatgcttctggtctgagtaaagctagtgaagcatcaagaaggatggtggct
cagaatccagtggaccctccaggaaagccagaagtgactgacctgacaaaatcaactgtg
tcgatcaaatggtctgtgccactgaatgatggtggcagagaaatagtaggttatattgtg
gaacgcaaaccatacagtgctactggagatggtcgctggctcaagtgcaactacacaaac
attacagacaccagttttactataacagcactaggtgaaggagaagtgtatgagttccga
gttattgccaagaatgcagatggagtctacagtttgccttcagaatcaacggggcctgtg
acatgcaaggctgaatatcagcctcctgtggcagagcttgacagtaaacttctcacagac
actgtcactatcagagctgggtcagacctggttcttgatgccgccattggtggtaaacct
gaaccgaaagtcttctgggcaaagggagacaaagaactagagctttgtgaaaagtatacc
ctgcagtatacaaagagccgtgctatggctattatcaagttctgtgatagaaatgattct
ggaaaatacattctgactgtaaagaatgccagtggagtcaagacagctgctgtcaatgtt
aaagtgctagacactcctgggccttgcaagaagattacaattacaggagtgactgagcga
aaatgcacagtttcctgggaaatacccatggaggatggtggagacccaatctcccactat
attgttgaacgacgtgacaccaatagacttaactgggtaatagtggaagctgaatgcaag
gctctttcttgtattattacaaatatgatcaagaaccttgaatacgtctttcgtgtccga
ggtgtgaacaagtacggcccaggtgttccactgcaatctgaatcaattgttgcccggaac
cttttcacaatcccttcacctcctggagtacctgaaatcattaacgttggaaaagatttt
gccattattcagtggtcaaaacctgaatctgatggcggcagtgaaatcagtaactatctt
gtggaaaaacgtgaaagaaaaagtgtgaggtggatcaaagttaacaaagatctcacaatc
acagacacaagttttaagatttatggtcttctagagggcaacatttaccagttccgtgtt
acagctgtaaacgcagcgggtgaaagtgagcccagtgcagtttcactctatgcttcttgt
agggaaccaacatatactccagctcccccatctattccacgtgtggtagataccactaca
gacagtataagtcttgtttggacaagaccagtgcaggatggaggtgctgatgttattgga
tatattttagaggttcgagaagatggaagggagcagtggagcaaagttcatgaaaaactg
atcagaatctcagaatacactgcaactggcctcacttataagacaaagtatagctttaga
gtagctgcagttaatgttaatggtgtcggtgaattcagtgacgcctgtacagccagtgaa
cctttggaaagaactgaaataccagatcttgagattgatgatgagttgaagaagaccatc
tgcttgagagctggtggttcccttcgcctttttgtaactgtaactggacggcctgtccct
gaggtcaagtggagtaaacctggtgtagatctccagagccgaggattcattgaagtaacc
gacactcatacaactatgacaattaataaagtaaatcgatatgatgctggccaatacact
gttgaggctgagaatccatcaggcaagaaaacagcaaccatccttgtgaagatttacgat
actcctggaccaccaggtccacttaatattaaggatataacagacagttccgctgtcatt
acatgggatgccccaagtgttgatggtggtgctccagtaaataattatattgttgagaga
cgagaagcatcaatgagagcctacaagacagtaacatctaagtgccataagacatcatat
aaagtcactggactgccagaaggaatgctttattattttagggtctttccagaaaatatt
tatggcattggtgagccacgtgaatccagtgatgttgttctcgtatgtgaggtgccgatg
gttccacaaaaacttgaagttatggatgtaacaaaatccactgtaacactcgcatgggac
aaaccacttcatgatggtggcagtaggcttactggatacgtcattgaggcttgcagattc
ggaacggagaaatggatgaaggtggccactttaaaaacaactgactttcagcatactgtt
gtatcacttaatgagaatgatcaatacctcttcagggtaagggccataaactgcagagga
gttagtgaaccaagagagacggtgacagcagtaactgtccaggaacaaaaagttttacct
aagattgatctctctggaattcctcagaagattgttaatgtactatcaggaaaatcagtt
gagctccatgtaccaattgctgggagtcctgctccagtttgttcatggtactttggtgat
gtaaagatgagggtacgtgaccgggtcaaaattgtgaccacaaaaacttactctgaactg
acagtttgtgacgccacaattgatgacacaggcgattatacccttgaagtgaagaatgct
gtaggcgctgtcacagagatcatcaaagtcatcattcttgccaaacctgatgaaccaaga
ggcccaattaggattgttgaatgtgatactacatcgattactataagctgggatccacct
gagagggatggaggtgccccagtttgtggctatgttgttgagcaaagggatgctcatcgc
ccaggatggttgcctgtgtctcaatctgtcagcagaactacatttaagttgaacagatta
acggagggcaatgaatatgtgttccgagttgctgcaactaatcgctttggaacaggatct
ttcttacagtctgatattgtgatctgcaagagcaataaaacaataccagggccaccagga
agacctgaagtgtttgatgtttctcgggatggcatgacaattgcgtggcacccaccagag
gaagatggtggatttgaaatatctggatatattgttgagcgtaaggaggttaggtctgac
agatggatacgtgccaacaagaatccagtgacaaagacaagatatagatctagtggccta
attgaaggccttgaatatgagcaccgagttactgctataaattctaaaggcactggaaaa
ccgagttttgtttctaaaacagcagttgcatctgatcctattgacccaccagactcacca
cagaatccaagagtcacagataccaccacaacatctgtttctctggcctggagtcctcca
gacgatgagggtggttccaaagttgctggatacttaatagaaatgcagaaggtcggaacg
tttcaatggattaaatgtaacacaacaccctcattaatctgtgaatacacactgacacaa
atgccccagggagctgaattcaagttccgtgtttcggcatgcaatgctggaggatctggg
gaacctgctgaaatcccaggaacagtcaaaattacagaaatgcttgaatcccctgatcat
gacctggaggctaagtacaaggatggatttgttgtcagacgaggtggagtcattaggtta
tctattcccatcaggggcaaaccaataccaacatgcatgtggacaaaagaaggacatgac
atttctcgtagggcaatgattgcttccagtgaagatctgactgagcttgtaattaaggaa
gcccaaagaaatgacactggagtatataaccttgtattgcaaaacaaatgtggcaaaaaa
tttgttagcatcaacgtgaaagtcatagggccaccagatccaccacaaggtcctcttcaa
attaatgacattcaggcttgctctgtccgactgacttggaaagctcctatagatgatggc
ggttctgatatacatagctacattgttgaaagacgagagatccctaatttggcttggtac
actgtggactcaaaagttgtagacacatctctggttgtcaagggattgcaagaaaatgtt
gagtatcacttcaaggtgacagctgtgaataagtttggcattagtaaatctctaaaatca
gaagaatctgtcacaccaaagacacctctctgtccaccggatcctccaagtaaccctcca
gaaattctggatgtcacagacaattcagtttctctattgtggggcaggcccaaaaatgac
ggtggttcctgtgtcactgcctattatgttgaacgcagggagagattcaatgaaaattgg
gtgcgtcatgacgcacatgtcacggctaacacatacaaactcactggactcattgctgag
aaggaatatcaattccgtgtgattgccaaaaatgatattggtgagagcttgccaggaccc
atatcagaattggttttatgcaaagatccatttgacaaaccaggtcagccaggagagact
gatactgtaaatgtgaccaaagactgcatttctattcgttgggagccccccagatatgat
gggggaaaacagatccttggctactgggttgaatacagaaaatctggagaaagtacttgg
aagaagtgcaacaaagaacgattgaaagacacagtgttcaccatgacttgtcttttagag
gctacggaatatgaatttagagtatttgctgaaaatgaagctggaatcagcagaccacgc
agaactaccgttggcataaaaaccaaactgagtgtcgtacataaaccaagtattataaaa
gaaatggaagatgcaacaactaagcttggacagccaggcacactgaagtgtcagatcact
ggaagacctcttcctgttatcaagtggtatagacatggaaaagaattacttcagggaaaa
aaatatgagatgaactccgatggtcgcaaccattcactgacaataacatcaaatcaacaa
gatgatgaaggagtttatacatgcaaagctatcaatgaagcaggagaaactgaaaccagt
ggaagtctcatttttgaggctgctccgatgctttctcctgaatatcctttgaaagaaata
tatcatattgtgtgtggtgcaagcctacgtctacatgttatgtacattggtcgccccgag
ccaaagatcacgtggcttcacaacaatgtacctctgcaaccaactgagaatgtcatcatt
gaaaacacaaaacattatacccatcttatcattaagaatgcacagcgtgagacaaacaca
gggaagtataaagtccagctcagcaacacatttggcacagctgaaaaactgcttcatgtc
gaaatccaagataaaccaggtacacctgaaggaccaataattgttgaagccctgctaaag
aactctgtgatcattagctggaaaccacctgcagatgatggtggggcaatgattacaaac
tacattgtggagaagtgtgaagatacctctagtgaagagtggaatcttgtgtcatcatca
gtctctggaacatcttgtcgaattccaaatctcaatgaaggtgccggatattactttcgt
gtttctgctcaaaaccaatatggagtgagtgatccattacagattccttctgtggtcatt
attaaaagtcagttagagaaacctggaaatccccaaaatctggttgttagtggagtgaca
aaggattcttgtattgtgtcttggataccaccgctgaatgatggaggttctaaaataaaa
aattattgcctggaaaaatgtgaaaaagagaatgaatggatctcagtaactacagatgaa
atccatcaaacagtatacactgtaaatgggcttgttgaaaactcagaatacaaattccgt
gttaaatgtgacagtctatggggagaaagtgactatagtgaagtgtctgcccgtgttgtt
ccaaaatcagatgtagctattcacacacctgcctttaaggaggaattaagaaacatgagt
gttaaatacaagagcaatgcaacttttgtttgcaagatcagtggacagcctaaacctgtt
gtcaaatggtacaagcgtggcaaagaaattcagcctgatggacaaaaaattaaagtccag
gaacgcaaaggtggttattatcagcttgtcatatctgctgctgatgaggaggattccact
gtctatcaagtcagagccacaaaccaaggaggctcaatttctgcaaatgtttcacttgat
gttgaaattcctgcaaagattcacttgcccaagcatatacaaaacaaagaatctattcct
gcccttcgtggtgaagtcattagtatcaagattccattcagtggcaaacctgacccagta
ataacatggcaaaagggacaagacctcattgatagcaatgggaactatcaagttattgta
acgcgatcttttacttcactaatattccccaatggagttgagaggaaggatgccggtttc
tatgttgtttgcgcaaagaacagatttggcattgatcaacagacagtggaactttatgtt
gcagatgtacctgatccaccaagaggtctcaaagtcagtgatgtgtctagggattctgtc
actctgaattggtgtgcccccgctaatgatggaggaagtaaagtcactaactatatagtg
gaaaaatgcgctaccacagctgagagatggattcgtgtagcacaagctcgtgacactcat
tatacagttgttaacctgtttggaaaaacaagttaccaattccgcgtcatttcagaaaat
aaatttggccaaagtgagccatctgaaccaactgatccagttgtaacaaaagaagataag
tcaagagcactgagctatgatgaggaagttgacgacacaggagaagtcataaagcgtaaa
gcactacattcagaaactgaagttctgcataataagtacatgattgcagaggaactagga
cgtgggcacttcagtattgtccaccgatgtgtcgaaaacagtacacagaagacattcatg
gctaaatttgtcaaagtaaaaggtgcagatcaagcactggtgaagaaagaaattgctaca
cttaatgtagctcaacacaagaatttcctgtgtcttcatgagtcctttgaaagtccagaa
gaattagtcatgatacatgactttacctcaggaatggatatatttgaacgtattggggca
gccaactttgaactttcagaacgagaaatagtaacgtatgtcagacagttatgtgaagct
cttgagtttctacatagtaagagctatgggcactttgacattaagcctgaaaatattgtc
tacaccaaaagtagtagctctaacatcaagataattgagatgggccaggctcaatacctt
acaccgggggaaaccataaggatccagtttactgccccagaatattgtgcaccagaaatc
caccggaatgaaatggttagcactgtaactgatatgtggtcagttggtgtcctagtgtac
atacttcttagtggacttaatccattcatagcagatacttatcagcaaacaattgaaaat
atttcaaatgctgaatacatttttgatgaagagactcttaagatatccagtcttgaagca
ttagattttgtggaccgtcttctgactaaggagcgtaaacatcggatgactgcttctgaa
gctttggaacatccctggcttcgaaaaaatatagaagaatacaattctaaagctataaag
acaacaagacacaaaagatattaccagaccttagtgaaaaaggaatggaatgttgttatt
tcagctgctcgtgttgctagaggcggcgctttaagaagtcaaagaggagtcacagtgagc
aaagttaaagttgcaccatatgaacatggcccacgagctggtcagattaagcattctgtt
tctgaagaaggcgggcatgcaaaatttgtctgtcacattgagaactatgacagtagcaca
gaagtgacttggtactgtggagttagacaaattgaggaaagtgaaaaatataaaattagt
tatgatgaaggagtaactatcttatctatcgaaaatattagcagagcagatgatgggaca
tataggtgcaaagttattaatgaatatggtgaagacagtgcctatgcagagctatttgtc
aaaaatgtaagatcttattctgatttcttttttgcacgcacagtaaagaaagcaaaacgt
agggtggatacagaaagactgcttcagagaccccctgaatttactttacctctatacaat
cgggctgcttacgttggtgaggatgtgcgttttgcagtaacaataactgtgcatccggag
cctcgggttacatggttaaaatctgggcaaaagattttaccaggggataatgacagaaaa
tatacatttataaatgacaaaggtctgtatcagctcataattcacaatgtacaaacagag
gatgatggtgaatacacagttttagcccgcaacaaatttggagatgacagttgcaaggca
cgtcttactgtatcacctcgcccagcaccatcagataatacactacggccaatgttcaag
cgcttgctagcaaatgcagagtgcaaagagggtcaaagtatccgctttgaaatgagagtc
tcagggtcaccttcgctgaagtgggagaaagatggaatgcaattagcatttggaccacaa
gttgaggttattcatgaagggcttgattattatgttctacatgtcagagatacacttcct
gaagattctggtacctatagagtcattgctacaaactccgctggatctgcaagttgtcaa
gccgcattaaaggtacatcgtctcactcatgtcaagaaagaatatgatactgaagaacag
aaaaagacatgtcctgaggagaaaaaaattgagaagaaggtgagactgttgcaaattctt
tctggcagtgaagttattccacttactccagtggcacaagaggctttaagagaagcatta
attatgcataaaccagaaatatcaacaaagaaagacaggattgaagctgttgataaaaag
gaaaaagaagaaggaaagatgagagcagaggacaagagacttcatatgccatatgaaatt
ccacaacctcgtgtccatgctccaacaaccctggaagaagacctggaaatcaaacatttt
gtgccttattcagacatgaaatggtataagaaaatccgggatcagtatgacatgcctgag
agaatggaaaaacctgttcagaagaggcttaaacgcattagtttatcaaagtgggagcag
aactatgttgtgccacttccaagaatcaaggatcagtacaagcctaaatggcgcatccct
aagttttcacaagatgacttggaaactgtaaggccaggaagatatcgtgcatcatctcca
gaatctgaagtttactataggcaaagaagaaggtccctctgtgatctcacagatgaagag
tttcttctccctgttcaagactatttatcaatgaaaaaaactgaagaagaaaggcttcgc
tttgaggaggagctccagcttggcttctcaggttctactttcagttctgtggactttgaa
ttgtcttcattgcgtcaattcccatcaaagaaaatgacatctgaggagaagaaagtagaa
gatgttgaaacgtatgactcatatcatattccctctaagtatgaaactggaccaagctat
attgatctgcgccaacgccatgataaggtgacatatagacctccaagacaaaaccaaaga
gtgcttgaagacaaagaagatcaagaacttcttcgtccaatagcttcaatgcagagacat
tgtgcttacaaaagtgagatgaagcgcatgcagtttgatgagaaaatccaattgtcaaga
aaagaaaaaagtaaggttcacgtttcaccattaattgaagaaaaaatggaaaaaaatgaa
tatccatctgctttgttaccttccccctttacacaagtaattagtaggtctttattgcct
tcacatggtgaattagtgcatcccttatctggaaatgtacaatctggcagtacacttcaa
gctagagaggaagagagtgaaacaatagaaaggatatcaaagatttctgagagaacacgc
accagtagtccgattttaggtgaattattattacctgagaaacatacaacaactgacata
atggccacatatgcggcaaaaaaggctgctctgaaatctgaaagaaaatatgaagttgtg
actcagcaacctttcagccttgaccatgccccacgcataactgtcagaatgcattctcat
cgtgtgccttgtggccagaaaaccaaatttactctaaatgtgcaagccaaaccagaatct
gaaattaaatggtaccacaatggaaagcagattcaagagagtagcaaattctgttttaca
aacataagtggagttctgtctcttgaggtacttgactgccaacaagaggacagtggcacc
tatcgtgttgtttgcacaaactacaagggagaggcctcagattatggcactttagatgtt
tcaagaggtgaatattctgcatattcatcccattacaaagatgaggaatctctcccagct
gttgttcctgaaattaccaagactgatttttaccatttgtcctctgttaaaccagtttct
gcatctgaaacccttatagtgttgaaggaaactaaattagagctgagtgaaatgcatcca
gtaagttcatgtgaagaatatgcttcaactgaaaagaaaactacagcactagagaaaata
actccacaagagaaggtgaaaacaattctgccagctagaatacttaaaaaacctcaatca
ttaatggtacaagagggacagtttgttgaatttatttgcgatgtagatggcgatccatca
ccaagtgttacctggaggcgtgcaggtcaagaaattgtctcatctaaccgttaccacatc
atcacatcacagtacaagtcagcttttgaaataatgaaagtacagttatctgatgaaggc
aactacacagtagttgtagagaattcggatggccatgaagaggtggaatttacactaaca
atttgcatgtcaactgatgaagagaaaatagcagtttctccatccaagtcaccagtgtca
gccagcaccaaagagcatgtcgagtcatctgcagacacaaaaacaaggactaagtcttca
gaatctgagatgaaacctttagacatttcagatgcttcatccccagattcttataagtca
cctgaagaatcatctgttgtaaaaacacctcctgaaccatctttatctccagtgaaggtt
cagttcccaccagaagaagaatctcaagaagtgcaaaagcctccaaagattgtaaatcag
cttaatgcaaaggcttctgaggacaaaataattatgtattgtgttgttgaaggttctaca
gacacagtaatatggtacaaagatggaattaacctgacacaggataggcactactatttc
catacttctactgatggcctttgcagtatgaatatcagtgatattactgagagtgaccaa
ggagaatatacttgtgaaattatttctgaaggaggggtgtccaaaacatcattttcattt
gttggccaagtgtttcaaaatatattgaaaaaaatctcaacatttctggaggaaaataaa
tgtttagatgaaaaggaaacagacatctccataacaaagccaacctcaggaagtctcgca
gccaataaagaatcgcaaatagaaactcagaaagaggctccttcagagtctcatatactg
aagaaggtgacagagcaaataaaaccagagatttttcatgaagaagttcaatctcacaca
gaaattaaagtaactcatagccaggtaacagcgtttgagggtcagtcccttattctgaaa
gcagaaatccctggagtattttgtgtaaaatggctccttaatggaaacgagttggttaat
tcagaagattatacatatgggatgtctgagaatgatcaaactttgaccatcaagaatatc
agtcagcatgaagagggaacaatcacatgtgaagctaaaactgaaagtggaattgtaaaa
tgtcactttcatacaaccctttctgcaaaacctgaaggacgaccttcattttgtattcta
ccaaagtctcagaatgtcaaagaaggacaaaatgtgattttcacatgtgaattacatgaa
ggttcccctgtagaaattgaatggcttaaggacaatgttgaggtattgtggacatccaac
ctaaaagagagtcattctaaaaatatatatacactagagattaaagaggcgtctactgga
gacagtgggaaatatacaataaaagcaaagaatattcatggacaatgttcagctactgca
tcattaaatgtacttgcgctgactgaagaacctgataaaagtgtacttttagaaaaagat
gaattggctgctagtatgcttggacgtttctccgcgaaggaagtccacatggctgcctcc
atgcaggagacctccttcagaagcactagcttaaccgaaatgaaatttgcaagtgcgtct
gcgtacagcacgcagtctttgacagcggaaatagcattgagctctagcagtataatggaa
atgtcaagccatttacaaatagaggggtcctctaaaggagccattacccaaggtttacca
ccaaaaatcaaaacacttcctgaagagatctgcattgagaagggaaagattcttactgta
gcctgtgttttctctggagaacccctgcctgagattgagtggacacattcagggattaca
ttaccctctacagaggaaagtgacaggctcaatattgagaccactgaggatctcaccacc
ctcatcatcactagtgtgaaagaaaatgatgctggatcttacacccttaaactatccaat
gagtttggctctgacactgcaacagtaaatgtcattatttgctaa

DBGET integrated database retrieval system