KEGG   Paramormyrops kingsleyae: 111840085Help
Entry
111840085         CDS       T05788                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00564  Glycerophospholipid metabolism
pki00565  Ether lipid metabolism
pki00590  Arachidonic acid metabolism
pki00591  Linoleic acid metabolism
pki00592  alpha-Linolenic acid metabolism
pki01100  Metabolic pathways
pki04010  MAPK signaling pathway
pki04217  Necroptosis
pki04270  Vascular smooth muscle contraction
pki04370  VEGF signaling pathway
pki04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111840085
   00565 Ether lipid metabolism
    111840085
   00590 Arachidonic acid metabolism
    111840085
   00591 Linoleic acid metabolism
    111840085
   00592 alpha-Linolenic acid metabolism
    111840085
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111840085
   04370 VEGF signaling pathway
    111840085
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111840085
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111840085
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111840085
Enzymes [BR:pki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111840085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 111840085
NCBI-ProteinID: XP_023660295
Ensembl: ENSPKIG00000006741
Position
Unknown
AA seq 711 aa AA seqDB search
MSDMVPYQYIIVENQYSHKFRVTVVRAEDITKGEWGDYLDISDPYVEVCVPAVSKTKKRT
RQIGNSVNPEWNETFEFILDPSQENVLEVTLMDANYVKDQTLGTALFTISDIKVGQTQLI
PLLIGDATKVYLEMSLEVCSIKDLRLSLALCDKEKFFQEARRQKVMLGIQKLLNTEKSCF
LPTTRQEVPVIAVMGSGGGFRAMVGFAGVMKALFESGVLDCATYIAGLSGSTWYMSKLYS
HPDFPTKGPSEINQELTKSVANSPMRLLTPQHLYQYVHVLQSKKAAGQPVTFTDIFGMLI
GNTLIPGYMDMKLSQMAEKVDDAQNPLPLFTCLHVKPDVSELIFADWVEFSPYEIGMVKY
GTFMTPDLFGSKFFMGSVVKRFEESPLHFLMGVWGSAFAILFNRLFGGQAHRRGSTLEEE
LGKRHFLLWVGVYIHMYCNESHPQEQNSWPPHMFTSLISNSAILKSREGRASKVHNFLWG
LRLSALVPHSPCGDLAKEALAAQEADAVEEPNEFNRIYEPLDPKSKKIHVVDSGLSFNLP
YPLILRPERGVDLIISFDFSARPSDSSPPFKELRLAEKWAHLNKLPFPKIDPKVFDREGL
KECYVFKPEDGQRNCPTIIHFVLANTNFRNFKSPGVPRESKVEQESADFDIFDDPENTYS
TFNFHYSTEAFARLHDLMEFNTLNNIQVIKDTIKDCVLDRRGNPPCVPISL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacatggtcccttatcagtatataattgtggagaaccagtactcacataagttc
agagtcacggttgtgagggctgaggatatcaccaagggagagtggggtgattatttggac
atctcagatccttacgtagaggtgtgtgtgccagctgtctctaaaaccaaaaaacggaca
aggcagataggcaacagcgtgaatccagaatggaatgaaacttttgaattcatattggac
cctagtcaggagaatgttctagaggtcacgctaatggatgccaactacgttaaggatcaa
acactgggaactgcattgtttactatctctgatattaaagtgggacaaacacaactgatt
cccctcctcattggtgacgctaccaaggtgtatttagagatgtccctggaggtttgttct
atcaaggatcttcgcctgagcttggctctctgtgacaaggagaagttcttccaggaggct
cgtcggcagaaggtcatgctgggaatccagaagcttttgaacacagagaagagctgcttc
ctccccaccacccggcaggaagtgccagtgattgccgttatggggtctggaggtgggttc
cgggccatggtgggctttgctggcgtgatgaaagctctctttgagtctggagttctggac
tgtgccacctacatagctgggctctctggatccacctggtacatgtccaaactgtactcc
caccctgattttccaaccaagggccccagcgagattaaccaggagctgacgaagagtgtg
gccaactctccgatgcggctgctgacgccacagcacctctatcagtatgtccatgtgctg
cagtccaagaaggcagctgggcagcccgttacattcacagacatcttcggcatgctcatc
gggaataccctcatccctgggtatatggacatgaagctgagccagatggcggagaaggtg
gatgatgcccagaacccgctgcccctcttcacctgcttgcacgtcaagcctgacgtgtca
gagctcatattcgcagactgggtggaattcagcccttatgagattgggatggtgaagtat
ggaaccttcatgacccctgatctctttgggagcaagttcttcatgggatcagtggtgaag
cgctttgaggaaagcccccttcacttcctcatgggcgtgtggggcagcgcctttgccata
ctctttaatcgactctttggaggccaagcccacagaagggggagcaccttggaagaggag
ctgggtaagaggcatttcctgctttgggtgggtgtctatatacacatgtactgcaatgag
tcccaccctcaggagcagaacagctggcctccgcacatgttcacctctctgatcagcaac
tccgccatcttgaaaagccgggaaggccgggccagcaaggtgcacaacttcttgtggggc
ctcaggctgagcgccttggtgccgcactcgccttgtggggacctcgccaaggaggccttg
gctgcacaggaggcagacgctgtcgaagaacccaatgagtttaatcgcatttacgagcct
ctggatccgaagagcaagaagatccatgtggtggacagcggccttagctttaacctacca
tacccgctcatcctcaggccagagaggggcgtggacctcataatatcattcgacttttct
gctaggccgagtgattcctctccaccctttaaggagcttcgcttggctgagaaatgggcc
catctgaacaagctgcccttccctaagatagaccccaaggtgtttgaccgagagggcctg
aaagaatgctacgtctttaagcctgaagatggccagaggaactgccccaccatcatccac
tttgtgctggccaatactaacttcaggaacttcaaatctccaggtgtgcctcgggagagt
aaagttgagcaggagtctgctgactttgacatatttgatgatccagaaaacacctattcc
acgtttaacttccactactccactgaagcctttgctcgactgcatgacctcatggagttc
aatactctgaacaacatccaggtgatcaaagacaccatcaaggactgcgttttggacagg
aggggtaacccaccatgtgtccccatctccctttga

DBGET integrated database retrieval system