KEGG   Paramormyrops kingsleyae: 111840237Help
Entry
111840237         CDS       T05788                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1-like
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00760  Nicotinate and nicotinamide metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111840237
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     111840237
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     111840237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 111840237
NCBI-ProteinID: XP_023660643
Ensembl: ENSPKIG00000013546
Position
Unknown
AA seq 304 aa AA seqDB search
MSRKRPIASAKRAHTARSFDEVPKKTNVVLLSCGSYNPVTNTKLCMFEGAREHLQTKGHY
EVVKGIISPVADGYNKKGLIEASHRVEMAKLAVENHSWIEVDSWESRQAEWLETVKVLRH
HRQELLSQEPDTDVVGTTKAGRKRKRMDASSATKRRKLEEAETAPKGTPQKTDEPRLMLL
CDAELLDSFVVPGLWKPEHIEEIVSNFGLVCMAHYKSNPEAIIRGSDLLWPHYRNIYVVR
DWVGVDVSSTYTRQRMLPGYSAQYLINDPVLRYIQERRLYTPESEQRNADVLLAPLQKLV
GNHG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaaacgtcccatcgctagcgctaagcgcgctcacactgcgcggagctttgat
gaggtaccaaagaaaaccaatgtggtgctgctgtcttgtggctcatacaacccagtcaca
aatacgaaactgtgcatgtttgaaggagcacgtgagcacctgcagaccaaaggacattat
gaagttgtgaaggggatcatatcaccagtggctgatggctacaacaagaagggcctgatc
gaggccagccatcgggtggaaatggccaagctggcggtagagaaccacagctggattgag
gtggacagctgggagagcaggcaggccgaatggctggagacagtcaaagtgctacggcat
caccggcaggaactgctctcccaggaaccggacactgatgtggtgggcactacaaaggct
ggcaggaagagaaaacgcatggatgccagcagtgccaccaagaggaggaagctggaggag
gcggagactgcacccaaggggacacctcaaaaaacagacgagccgcggttgatgctactc
tgtgatgctgaactgctggactcctttgtggtgccggggctgtggaaacctgagcacatc
gaggagatcgtcagcaactttggactggtgtgcatggcccactataaatctaatccggag
gccattattcggggctccgacctcctctggccacactaccgcaacatctacgtggtgcgc
gactgggtaggcgtggacgtgtcgagcacatacacccgccaacggatgctgcctggctac
agtgcccaatacctgataaacgacccagtcctccgctacatccaggagcggcggctctac
acgcctgagagtgagcagaggaacgctgatgttcttctggctccgctgcagaaactcgta
gggaaccatggctga

DBGET integrated database retrieval system