KEGG   Paramormyrops kingsleyae: 111840533Help
Entry
111840533         CDS       T05788                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04020  Calcium signaling pathway
pki04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111840533 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111840533 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pki04030]
    111840533 (oxtr)
G protein-coupled receptors [BR:pki04030]
 Rhodopsin family
  Peptide
   Oxytocin
    111840533 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 Gaa1
Motif
Other DBs
NCBI-GeneID: 111840533
NCBI-ProteinID: XP_023661236
Ensembl: ENSPKIG00000024683
Position
Unknown
AA seq 388 aa AA seqDB search
MESAYRDLDLWPVNESWKNGSFNNDTEGGNQTVNALKRNEEVAKVEVAVLVLVLLLALAG
NACVLVAIHTTKHGQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVK
YLQVVGMFASTYMLVLMSIDRCMAICQPLHSLHRRKDRFYVIVSWTLSLLFSTPQVYIFS
LKEVGNGVYDCWGEFVQPWGAKAYVTWISITIYIMPVTILSICYGLISFRIWQNLKLKRK
EHCITLTPKASKGAALSRVSSVKLISKAKIKTVKMTFVIVVAYIVCWAPFFFVQMWSAWD
PAAPREEIAFIISMLLASLNSCCNPWIYMCFAGHLFHDLVQRFVCCSTHYLKSSQCHCER
ESSHRSNTSTFVIKSTTSQRSITQTSIT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgcttatagagatctggatctctggccagtaaatgagtcctggaagaatgga
agttttaacaacgacacggaagggggtaaccagacggtgaacgccctgaaacgaaacgaa
gaagtagccaaagtggaggtggccgtactcgtcctggtcctgttacttgccctagctggc
aacgcgtgtgtcttagtggcgatccataccacaaagcacggtcaatcacggatgtattat
ttcatgaagcatcttagcatcgccgatcttgtggtggcagtctttcaagtcctgccacaa
ctcatttgggacatcacgtttcgattttatggacccgatttcttatgcagactagttaaa
tatctgcaggtcgtagggatgttcgcttcaacttatatgctcgttctgatgtccatagac
agatgcatggcgatctgtcagccactgcactccttgcacaggagaaaggaccgcttttat
gtgatcgtctcttggactcttagccttttattcagtacccctcaagtgtacatcttttcc
ctgaaggaagtgggcaacggagtttatgattgttggggagaatttgttcagccatggggc
gctaaagcatacgtaacgtggattagtatcactatctatatcatgcctgttacaatactg
agcatctgttatggactaattagctttcggatatggcaaaacttgaaacttaaaaggaaa
gagcattgcataactctcacgcctaaagcatcaaagggcgctgcgctttctcgggtgagc
agcgtaaagttgatttctaaagcaaagataaaaacggttaaaatgacttttgtgatcgtc
gtggcgtacatagtctgctgggcgcccttcttcttcgtgcagatgtggtcagcgtgggac
cccgcggcacccagagaagagattgcattcatcatttccatgctattggccagcctgaat
agctgctgcaacccatggatctacatgtgttttgcgggccatctgttccacgacctggtg
cagcgcttcgtctgctgctccacacattacctgaagtcctcgcagtgccactgtgagcgg
gaatccagccaccggagcaacacctccacctttgtgatcaagagcaccaccagccaaaga
agcatcacacaaacctccataacataa

DBGET integrated database retrieval system