KEGG   Paramormyrops kingsleyae: 111840758Help
Entry
111840758         CDS       T05788                                 

Definition
(RefSeq) cAMP-responsive element modulator-like isoform X1
  KO
K09052  cAMP response element modulator
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pki00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111840758
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111840758
Transcription factors [BR:pki03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111840758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 Med18
Motif
Other DBs
NCBI-GeneID: 111840758
NCBI-ProteinID: XP_023661727
Ensembl: ENSPKIG00000010888
Position
Unknown
AA seq 211 aa AA seqDB search
MSNQHEPEIKSLNVPSSESLAIPVIKEVKSEEEEHTPLSESFADCFHTSSVPIPKKEPFE
VTTSENSDMWALQILSNPRTPVTVMSIVQCAAQSPGGKKLASLPGSNMAMQAATGDMSTY
QICSPTSSLPHGMVMASSPGSVPSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKVLKDLYCHKPE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcaacatgaacctgaaataaagtctctgaatgtgccatcatcagagtcactg
gccattcctgtgattaaggaggttaaatcagaggaggaggaacatacacccctgtcagag
tcatttgcagattgtttccacaccagctcagtccccatcccaaagaaggaaccatttgag
gttaccacttcagagaacagtgacatgtgggctctgcagatcttgagcaatcccaggaca
cctgtgacagtgatgtccattgtgcagtgtgctgcccaatcgccaggtggaaagaagctt
gcttccctaccagggagcaatatggctatgcaagcagccaccggtgacatgtcaacctat
cagatttgcagccctacctccagcctgccccatgggatggtgatggcctcatcaccgggg
tccgtacccagcccacagcagctggctgaggaagccacacgcaagagagagctccgtctc
atgaagaacagggaggccgcccgggagtgccgcaggaagaagaaagaatacgtcaaatgt
cttgaaaatcgcgtggctgtactcgaaaaccaaaacaagactctcattgaggagctcaaa
gtgctaaaagacctctattgccataaacccgaataa

DBGET integrated database retrieval system