KEGG   Paramormyrops kingsleyae: 111840796Help
Entry
111840796         CDS       T05788                                 

Definition
(RefSeq) nucleolar protein 58-like
  KO
K14565  nucleolar protein 58
Organism
pki  Paramormyrops kingsleyae
Pathway
pki03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pki00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    111840796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pki03009]
    111840796
Ribosome biogenesis [BR:pki03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    111840796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 111840796
NCBI-ProteinID: XP_023661810
Ensembl: ENSPKIG00000003585
Position
Unknown
AA seq 533 aa AA seqDB search
MLVLFETAAGYAIFKVLDEQKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAA
TALVEGKIGKSLKKVLKKVVAKEAHEQLAIHDAKLGGVIKEKLNLSCVHSPAVAELMRGI
RNQMEGLITGLPPRDFSAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY
IMRCREWYGWHFPELGKIVTDNLAYCKAIRKIGDRTNVASTDLSDILPEEVEAEVKLAAE
ISMGTEVSEQDICNIVHLCDQVIEISEYRAQLYDYLKNRMMAIAPNLTVMVGELVGARLI
AHAGSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKYGLIYHASLVGQTTAKNKGKIS
RMLAAKAALAIRYDALGEDTNAEMGVENRAKLEVRLRQLEEKGIRRISGAGKALARADKY
QHKSDVKVYDPSADSTIPTASKKRRFEEVEESEEPVEVKPKKVKKESVPQEAEAEMETET
PKKKKKKKKEKAEVVEEPEEVAEEEVEVAPASEETTEKKKKKKKKKIKEEEED
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctctttgagactgctgcgggctatgctatttttaaagtcttagatgagcag
aagctgcaagaggtcgacagcctttggaaagagttcgaaacgccagagaaagcgaataaa
atagttaaactaaaacatttcgagaagttccaggacaccacagaagcattagcagctgcc
acagcactggtggaggggaagattgggaagagcctgaagaaagtcctcaagaaggttgtg
gccaaagaggcccatgagcagctggccatccatgatgccaaactgggtggagtcattaag
gaaaagctgaacctgagctgtgtgcacagccccgctgtcgccgagctcatgaggggcatc
cggaatcagatggaggggctgatcacggggctgcccccgcgcgacttcagcgccatgtcc
ctgggtctggcgcacagcctctctcgatacaagctcaagttcagccctgacaaagtggac
accatgattgtgcaagccatctctcttctggatgacctggacaaggaactgaacaactac
attatgcgctgtagggagtggtatggctggcatttccctgagctgggaaagattgtaact
gacaacttggcgtactgcaaggccatccgtaagatcggtgaccgcaccaacgtggcaagt
accgacctttcggacatcctacccgaggaggtggaggcggaggtcaagctggcggcagag
atctccatggggacagaggtgtcggagcaggacatctgcaacatcgtgcacctgtgtgac
caggtgatcgagatttcagaataccgtgcgcagttgtacgactacctgaagaaccgcatg
atggccatcgcccccaatctgacggtcatggtgggggagctggtgggggctcggctgatt
gcgcatgcagggtctctgttgaacttggccaagcacccggcctccacggttcagatcctg
ggggctgagaaggccctcttcagggcactgaaaaccaagcgagacaccccgaaatatggg
ctcatttaccacgcctctctcgtgggtcagaccacagctaagaataagggcaagatctcc
agaatgctcgctgccaaggcggcactggctatccgctacgatgctctcggggaggatacc
aacgcggagatgggtgtggagaaccgcgccaagctggaggtcaggctgcggcagctcgag
gagaaggggatccgacgtatcagtggggcaggaaaagcactggccagggctgacaaatac
cagcacaagagcgacgtcaaagtgtacgatccctctgctgactccacgatccccacggcc
tccaaaaagaggcggtttgaggaagtagaggagagcgaggagccagtggaagtcaaaccc
aagaaggttaaaaaggaatctgtaccacaagaagctgaggcagaaatggaaacggaaact
cccaagaagaaaaagaagaagaagaaggaaaaggcagaagtggtggaggagcctgaggaa
gtggcagaggaagaggtggaggtcgccccggccagtgaagagacaacagaaaagaagaaa
aagaagaagaaaaagaaaatcaaggaggaggaagaggactga

DBGET integrated database retrieval system