KEGG   Paramormyrops kingsleyae: 111842133Help
Entry
111842133         CDS       T05788                                 

Gene name
tnks
Definition
(RefSeq) tankyrase-1 isoform X1
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pki03032]
    111842133 (tnks)
   03036 Chromosome and associated proteins [BR:pki03036]
    111842133 (tnks)
Enzymes [BR:pki01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     111842133 (tnks)
DNA replication proteins [BR:pki03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111842133 (tnks)
Chromosome and associated proteins [BR:pki03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     111842133 (tnks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 111842133
NCBI-ProteinID: XP_023664222
Ensembl: ENSPKIG00000021889
Position
Unknown
AA seq 1253 aa AA seqDB search
MAASRRSSQQQQQQTLSSPPRSASLSLTPPGSPPGPVGAAILAPAGAEQDGGGDSEVAPA
SPDLPAPGLSGSGSSGSSGSSSTASGGSSPDSGGSSPGAGGAFRELFEACRNGDVSRVKR
LVDSVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFG
HAEVVGLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALD
LADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTSQKLLSTPL
HLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDL
WQFTPLHEAASKNRVEVCSLLLSHGADPTIANCHGKSAVDMAPTPELKERLTYEFKGHSL
LQAAREADMAKVKKTLALEVINFKHPQSHETALHCVAASPHPKRKQVTELLLRKGANVNE
KNKDFMTPLHVAAERAHNDIMEVLQKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLNY
GADPTIVSLQGFTAAQMGNEAVQQILNENVPVRNSDVDYRLLEAAKAGDLDTVKQLCSPQ
NVNCRDLEGRHSTPLHFAAGYNRVAVVDYLLHHGADVHAKDKGGLVPLHNACSYGHYEVA
ELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDMVKEG
DTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVA
EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQK
GRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLMDAMPPDALPSCFKPQATVVS
ASVISPASTPSCLSAASSIDNLAGPLADLTVSGASGPADGATGSDRKEGDTILDMNISQF
LKSLGLEHLRDIFEREQITLDVLADMGHEELKEIGINAYGHRHKLIKGMERLLGGQQGAN
PYLTFHCANQGTVLIDLAPDDKEFQSVEEELQSTIREHRDGGNAGGVFSRYNILKIQKVV
NKKLRERYVHRQKEIADENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYF
AENSSKSNQYVYGIGGGTGCPTHKDRSCYACHRQMLFCRVTLGKSFLQFSAMKMAHAPPG
HHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIQKPESTAQTAPGAEQKS
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctcgtcgctcgtctcagcagcaacagcaacagaccctgtcgtctcctcct
cggagcgcctccctctcgctcacccctccgggctctcctccgggacctgtgggtgcagcg
atcttggctcctgcgggcgccgagcaagacggcggcggggattcagaggtagccccggcc
tccccggacctgcccgccccgggcctcagcggcagtggtagcagcggctccagtggctct
agctccaccgcgagcggcggctcgagcccggactcgggcggctccagcccgggggccggc
ggcgcttttcgggagctcttcgaggcctgccgcaatggggacgtttcccgggtgaagcgg
ctcgtcgactcggtgaatgtgaacgccaaggacatggccggccgcaagtccaccccgctg
cacttcgccgcagggtttggcaggaaggacgtggtggagcacctcctgcagacgggcgcc
aatgtgcacgcccgcgacgatggtgggctgatcccgctgcacaatgcctgctcgttcggc
cacgctgaggtggtaggcctactgctgtgccagggagcagacccaaatgcccgcgacaac
tggaactacacacccctgcatgaggctgcaatcaaaggcaaaatcgacgtgtgcattgtg
ctgctccagcacggcgccgaccccaacatccgcaacaccgatggcaagtcggccctggac
ctcgccgacccatctgccaaggccgtcctcaccggtgaatacaagaaggacgaactcctg
gaagcagcaaggagcggtaacgaggaaaagctcatggccctgctcacccccctgaatgta
aactgtcacgccagcgatggccgaaagtcaacatcccaaaaattgctgtctaccccactg
cacctggcagctgggtacaaccgtgtgcggatcgtccagctactgcttcagcatggcgct
gacgtccacgccaaggacaaaggcggcctggtccccctgcacaatgcctgctcctacggt
cactacgaggtcaccgaacttctgctcaagcatggcgcctgcgtcaacgccatggacctg
tggcagttcacgccgctgcacgaggcggcctccaagaaccgggtggaggtgtgttcactg
ctgctgagccacggcgccgaccccaccatcgccaactgtcacggcaagagcgcagtggac
atggcccccacgcccgagctcaaagagcgcctcacctatgagttcaaaggccactccctg
ctccaggcggcacgggaggcagacatggcaaaggtgaagaagactttggccctggaggtc
atcaacttcaaacacccccagtcccacgagactgcgctgcactgcgtggcggcctccccg
caccccaagcgcaagcaggtgaccgagctactgcttcgtaaaggagccaacgtcaacgag
aagaacaaggacttcatgactccactgcacgtggctgcggagagggcgcacaacgacatc
atggaggtcctgcagaaacacggagctaagatgaacgcgctggacaccctgggccagacg
gccctgcaccgggcggcgctggcgggccaccttcagacctgccgactgctgctgaactac
ggcgccgatccgaccatcgtctcgctgcagggcttcactgcggctcagatgggtaacgag
gccgtgcagcagatccttaatgagaacgtcccggtgaggaactcggacgtggactaccgt
ctcctggaagcggccaaagcaggggacctggacactgtgaagcaactgtgctccccccag
aatgtgaactgccgggacctggagggccggcactccacgccgctacattttgcagccggc
tacaaccgcgtggctgtggtggattatctgctgcaccacggtgctgacgtgcacgccaag
gacaagggcggcctggttcccctgcataacgcctgctcctacgggcactacgaggtggcg
gagctgttagtgcggcacggggcctccgtcaatgtggccgacctgtggaagttcacgccg
ttgcacgaggcggccgccaagggcaaatacgagatctgcaaactactgctcaagcatggc
gccgaccccaccaagaagaaccgggatgggaacacgcccctggacatggtgaaggaggga
gacacggacattcaggacctgctgaggggcgacgccgccctgctggacgctgcgaagaag
ggctgtctggcacgcgtgcagaagctgtgcagcccagagaatataaactgcagggacacg
cagggccgcaactccaccccactgcacctggcggctggttacaacaacctggaggtggcg
gagtacctgctggagcatggggcagacgtcaacgcccaggacaagggggggctgatccca
ctccacaatgcggcttcctatgggcacgtggacatcgcggcactcctcatcaagtacaac
acgtgtgtgaatgccacggataagtgggctttcaccccccttcatgaagccgcccagaag
gggcgtacccagctgtgcgcgctgctgctggctcacggcgctgaccccaccatgaagaac
caggagggccagacgcctctggacctggccacggctgatgacatcagagctctgctgatg
gatgccatgccccctgacgcccttcccagctgcttcaagccccaggccacagtggtcagc
gcctctgtcatctccccggcctccacgccctcctgcctgtccgctgccagcagcatcgac
aacctggcagggcccctggccgatctcactgtgtctggggcctccgggcccgctgacggc
gccaccggctcagaccgcaaggaaggggacaccattctggacatgaacatcagccaattc
ctgaagagcctgggcctagagcacctgagggatatctttgagagggaacagatcacgctg
gatgtactggctgacatgggccatgaggagctgaaggagatcgggatcaacgcctacggt
caccgacacaaactcatcaagggcatggaaaggctgctggggggccagcaaggtgccaac
ccctacctgacgttccactgtgccaaccagggcacggtgctcatagacttggcccctgat
gataaggagttccagtcggtggaggaggagctgcagagcaccattcgggagcacagggac
gggggcaatgcagggggggtgttcagccgctataacatcctcaagatccagaaggtggtg
aacaaaaaactgcgggagagatatgtccaccggcagaaggagatcgccgacgagaaccac
aatcaccacaacgagcgcatgctctttcatggatcccccttcataaacgccatcatccac
aaagggtttgatgagcgccatgcctacatcggtggcatgttcggcgctggcatctacttt
gcggagaactcctctaagagcaaccagtatgtgtatggcattgggggtggtaccggctgc
cccacccataaagaccgctcctgttatgcctgccacaggcagatgctgttctgcagagtc
acattgggcaagtccttcctgcagttcagtgccatgaaaatggcccacgcccccccgggc
caccactctgtcatcggccggcccagtgtcaatggtctggcctatgctgagtatgtcatc
tacagaggagagcaggcctacccagagtacctcattacctaccagatacagaagccagaa
agcacagctcagactgctccgggcgcagaacaaaagtcctag

DBGET integrated database retrieval system