KEGG   Paramormyrops kingsleyae: 111842203Help
Entry
111842203         CDS       T05788                                 

Definition
(RefSeq) glutathione hydrolase 5 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00430  Taurine and hypotaurine metabolism
pki00480  Glutathione metabolism
pki00590  Arachidonic acid metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111842203
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    111842203
   00480 Glutathione metabolism
    111842203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pki01002]
    111842203
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pki04090]
    111842203
Enzymes [BR:pki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     111842203
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     111842203
    3.4.19.14  leukotriene-C4 hydrolase
     111842203
Peptidases and inhibitors [BR:pki01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   111842203
CD molecules [BR:pki04090]
 Proteins
  111842203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept FLgD_tudor
Motif
Other DBs
NCBI-GeneID: 111842203
NCBI-ProteinID: XP_023664359
Position
Unknown
AA seq 539 aa AA seqDB search
MGNARAKTLCILAMVVIIGLFFTVFRRNDRKAAVTADSEICSMVGRDILQEGGSAVDGAI
AALLCTSVVNPHSAGFGGGAIFTVMEETGNVKIINSRETVPVLFRPDLLKYCSNQEKGSR
WIGVPGQIRGLEQAHNLFGKLPWAKLFQPAVRMAREGVPVSADLDRILRRKVAGGSQFCD
ILCYGNKTVFRQGAVMRFPKLAETFEIIANYGANAFYTGRIARDLIQEIKEAGGTLAMED
LRSFQAKVADAWTVPIGEFIMHIPPPPAGGGILSLILNIMKGYKLSPSSLEGDQKALTYH
RYIEALKFANAQWKKTGDLDFDPTEELPLISDEFADRVRTVISDAMAEGLQDDNITLTLD
PFGTTHVSVLAPDGTAASVTSTTNQHVTSIAYSQKTGVTLNSELAGFCWKKNRILSGEEP
PSLIAPLIVYSKSQKKTLVIGASGGTMITTRLAMAMMNHLWFEKNLNDSISSPVLILNQN
GTVLYEQGFDESVVKKLKMFGHDMQETERVYNAVNAVLKEGSYISAVSDARMGGKAAGF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcaagggcgaagacgctttgtatcctggctatggttgtgattatcggtctg
ttttttacggtcttcaggaggaatgaccgcaaagccgcagttacggcagattcagagata
tgctccatggtcggcagagacatcttgcaagaaggaggttcggcagtagatggcgccatt
gcagcccttctttgcacctctgttgtgaatccgcacagtgctggctttggagggggtgcc
atattcactgtgatggaggaaactggcaacgtcaagatcattaattccagggagacggtg
ccggtactgtttagaccggacctgttaaagtactgctcaaatcaagaaaaaggcagccgg
tggataggcgttcccggacagattcgtgggctggagcaggctcacaatttgttcgggaag
ctgccatgggccaagctctttcaacccgccgtcagaatggcccgggagggggtgcctgtg
tccgctgaccttgacaggatacttcgccggaaagttgctggagggtcacagttttgtgac
attctctgctatgggaacaagacagtctttcggcaaggagccgtcatgaggtttccaaag
ctggcagaaacctttgagatcatagcaaattatggggccaatgctttctacacgggcaga
atcgcgcgtgacttgatccaggagataaaagaagcaggtggaactttagcaatggaagat
ctgaggtcctttcaggccaaagtagcagatgcatggactgttccaataggagagtttatc
atgcacatcccaccaccaccagcagggggaggtattcttagcctcattcttaacatcatg
aaagggtacaaactcagcccttcctcccttgagggtgaccaaaaagctctaacctaccac
cgctacatcgaggccctcaaattcgcaaacgctcagtggaagaagactggtgacctagac
tttgatcctacagaagaacttccattgataagtgacgagtttgcagacagagtccggacc
gtgatcagcgacgcaatggccgaaggtctccaagacgacaacatcaccctcacattggac
ccttttggtaccacccatgtgtcagtgctggctcctgatggcactgcagcatcggtcacc
agcaccaccaaccaacacgttacctcgattgcatattcgcagaaaacaggggtgaccctt
aacagtgaactggcaggtttctgttggaaaaagaatcgcattctttccggggaagagcct
ccatccttaattgccccattgatagtctattcaaagtcccagaagaagacgttagttatt
ggagcatcagggggcaccatgatcaccacaagactggccatggcaatgatgaaccacctc
tggtttgaaaagaacctcaacgattcaatttcgtctcctgtgctgatcctgaatcagaat
ggcacagtactttacgagcaggggtttgatgagtctgttgtcaagaagctgaaaatgttt
ggacacgacatgcaggaaacggaaagagtgtataacgcagtcaatgccgtgttgaaggag
ggatcttacatttctgccgtgtcggatgccaggatgggtggcaaagcggctggattctga

DBGET integrated database retrieval system