KEGG   Paramormyrops kingsleyae: 111842747Help
Entry
111842747         CDS       T05788                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pki04131]
    111842747
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pki04812]
    111842747
   04147 Exosome [BR:pki04147]
    111842747
Membrane trafficking [BR:pki04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111842747
Cytoskeleton proteins [BR:pki04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111842747
Exosome [BR:pki04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111842747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 FeoB_N AAA_16 AAA_22 Ras ABC_tran AAA_29 Gtr1_RagA GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 111842747
NCBI-ProteinID: XP_023665432
Ensembl: ENSPKIG00000010114
Position
Unknown
AA seq 427 aa AA seqDB search
MVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSGE
YPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFE
DYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTL
TPEECQQFKKQIMREIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNG
KRVRGRQYPWGVAEVENSEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTY
NGVDNNKSKGQLTKLDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKIQKL
KDSEAELQRRHEHMKKNLEAQHKELEEKRRQYEEEKVNWEAQQRVMEQAKLDASRTLEKN
KKKGKIF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggtagctcaacagaagaacctggagggatatgtgggtttcgcaaacctccccaaccaa
gtgtacagaaaatcggtgaagaggggctttgagttcaccctcatggttgtcggggaatct
ggtctggggaagtcgacgctgatcaactccttgttcctgacagacttgtattctggcgag
tatcctgggccttcccacagaatcaagaagaccgtacaggtggaacaatccaaggtgcta
ataaaggaagggggggtccagcttctcctcacaatagttgacaccccaggattcggtgat
gccgtggacaacagcaactgctggcagcccgtcatcgaccacatcgacagtaagtttgag
gattacctcaacgccgagtcccgcgtcaaccggcgtcagatgcccgacagcagggttcac
tgctgcctgtacttcatcgccccctcaggacatggactcaagccactggacatagagttc
atgaaaaggctacatgagaaggtgaacatcattccccttattgccaaggcggacacactg
actcctgaagagtgccagcagttcaagaagcagatcatgcgtgaaattcaagaacacaaa
atcaaaatctacgagttcccagagacggatgacgaggaggagaacaagctggtgaagaag
atcaaggatcgcctccccctggccgtcgtcggtagcaacaccatcatcgaggtcaacggg
aagcgcgtccgagggaggcagtacccctggggcgtggctgaagtggagaacagtgagcac
tgcgatttcacgatcctccggaacatgctcatcaggacccatatgcaggacctgaaggat
gtgaccaacaatgtccactacgagaactacaggagccgcaagctggcggccgtcacctac
aacggcgtggacaataacaagagcaagggtcagctgaccaaacttgatacagttgaaggc
atgagcccattggcacagatggaagaggagaggagggaacatgtggccaagatgaagaag
atggagatggagatggagcaggtgtttgagatgaaggtcaaggagaaaattcagaagctg
aaagactctgaggcagagctgcagcggcgtcacgagcacatgaagaagaacctggaggct
cagcataaggagctggaggagaagcggcggcagtacgaggaggagaaggtcaactgggag
gcacagcagcgcgtgatggagcaggcgaagctggacgcctccaggaccttggaaaaaaac
aaaaagaaggggaagatattttaa

DBGET integrated database retrieval system