KEGG   Paramormyrops kingsleyae: 111843386Help
Entry
111843386         CDS       T05788                                 

Definition
(RefSeq) TCDD-inducible poly [ADP-ribose] polymerase-like
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111843386
Enzymes [BR:pki01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     111843386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE
Motif
Other DBs
NCBI-GeneID: 111843386
NCBI-ProteinID: XP_023666692
Ensembl: ENSPKIG00000003548
Position
Unknown
AA seq 612 aa AA seqDB search
MAGEVPLKKRKVETQCTNQEGLAKPMVITVFSTSQLVLQIPAQTNTSLPVWQLIHTGQVE
VEWSEAPYNINIRITPLYPQAGSQTLSKTSATDQLVPVHQVPKLFTLPPVSAEPQTQSVV
PPQFQTVAMLPAQTVTLFRSLDGSHLQPLRPPIPSVDRVDPASCLSQPLPRTEWVQQAYF
HTRPRENIDICDNFLLGYCPRRSECPLHHTPYPFHWQIRRQDTHQWISTSHSAQLSLERL
YSNKERESVKLREETEEFTLNFDTMQIEDSDKYDLARRLSNTSDPLKNPHFPTEWNMYWW
DNCRWECYKKDITKELVTRMRAGESCCRFIIGKQQYEVDLKYLTQENLTTNFIRRVRCRP
TFRSPLSIKSNLRTVILSEAPDSSCQNYPSFSVDPLEIFTSWYPPVWTPTHDQDVNLVEV
PFGTEAYHQVHRLFHRTMSETKMEIVSIEQVQNVFQWDKYRRQKQHMHDRRLDQGGTLEM
HLFHGTTEDAAKDICWNNFDPRVSGKNGVVYGHGSYFARDASYSNDYARAPSPVGLQHMF
LAKVLVGNMSLGKRKYYRPPQLKTSMSKYESYNTCVNHLDNPSIFVVFDSGQCYPYYLIK
YRALSEVVDVYK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgaggtgcccttgaaaaagagaaaggtggagactcagtgcaccaaccaagaa
gggctggccaagcccatggtgatcaccgtcttcagcaccagccaactggtgctgcagatt
ccggcacagaccaacaccagcctgcccgtgtggcagttaatccacacgggtcaggtggag
gtggaatggagcgaggcaccctacaacatcaacatccgcatcacccctctttatcctcag
gctggatcccagactctctccaaaacttcagctacagaccaactggtgccggtccatcag
gtgccaaagctcttcaccctgccgccagtgtcagccgaacctcagacccagtctgtggtg
cctccccagtttcagactgtggccatgttaccagctcagactgtcactctgtttcgttct
ttggatggaagccacctacagcccctccgcccccccataccctctgtcgatcgcgtagac
ccagcctcctgcctatctcaacccctgcccaggacggaatgggtccagcaggcctacttc
cacacccgcccccgggaaaacatagacatctgcgacaacttcctcttaggctactgtccg
cgccggtccgagtgcccgctgcaccacaccccttaccccttccactggcagatccggcgc
caggacacccaccagtggatcagcacctcgcactcggcccagctcagtctggagcgactg
tactccaacaaggagagggagagcgtcaagctgagggaggagacagaagagttcaccctg
aattttgacacaatgcaaatagaagattcagataaatatgatttagccagaaggctctcc
aacaccagcgacccattgaagaatccacactttcccacagagtggaacatgtactggtgg
gataactgccgctgggaatgttacaagaaagacataacaaaagagctggtgaccagaatg
agagcaggagagtcctgttgcaggttcattattgggaagcagcagtacgaggtggattta
aaataccttacccaggagaacctcaccaccaattttatacgcagagtacgatgccgccct
actttccgttctcccttgtccatcaaatcaaacctcagaactgtcatcctgagtgaggcc
ccagattccagttgtcagaactaccccagctttagcgtggaccctctggaaatattcacc
agctggtacccacctgtatggactccaacccatgaccaggatgtcaacctggtagaggta
ccgtttgggacagaggcctatcaccaagtccataggctgtttcacagaactatgtccgag
actaaaatggagatcgtcagcatagaacaagtccagaatgtctttcagtgggacaaatat
cgcaggcagaagcagcacatgcacgaccgcaggctggaccaaggaggaacgctggagatg
cacctcttccatggcaccaccgaggatgctgccaaagacatctgctggaacaactttgac
ccacgcgtctctgggaaaaacggagtggtgtacggtcacgggagctactttgcccgggat
gccagttactctaatgactatgcaagggcgccctctcctgtgggtttacagcacatgttc
ctcgccaaggttctagtgggcaacatgagcctgggaaaacggaaatactaccgccccccc
caactgaaaaccagtatgagcaagtatgagtcgtataacacgtgtgtcaaccatttggac
aatccctccatctttgtggtatttgacagcggccagtgctacccttactacctcataaag
tacagggcactgtctgaggttgtcgacgtttacaagtga

DBGET integrated database retrieval system