KEGG   Paramormyrops kingsleyae: 111843764Help
Entry
111843764         CDS       T05788                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111843764 (thnsl2)
Enzymes [BR:pki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     111843764 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP YjeF_N
Motif
Other DBs
NCBI-GeneID: 111843764
NCBI-ProteinID: XP_023667362
Ensembl: ENSPKIG00000016221
Position
Unknown
AA seq 519 aa AA seqDB search
MDYLVTLMYRLLAKHPHRGTQFWQRTFSKGAIMRYCSTRGGTRGWDFRQVLFSGYAPDGG
MFMPESLPGLSADTLRSWASLSYPELVLEVCALFIPDDLIPRRDLADLLPQALSEFSVPG
AVRLAQLRDGLCVLELFHGQTMAFKDLAMTCVTRLLDYFLRREHRRATILVGTSGDTGGS
AICSARGLDGVDVLVVFPLGRITTVQERHMTTSLEDNVHVFAADGSSDDIDVPLRRLFAD
QDLVKNHGLMSLNSVNWARILVQLAHFLYAYLHLSDLQKVKGQELPTVEVVVPTGGAGNI
AAGCIVNLMGVPLRLVAMVNNNDIVHRVVQSGDYSMASSVKQTLAPAIDIQDPYNMERVL
WLLSDKNSALVKGLMEEFQSSHRLQLPEKLHKKLSAFISSGSVTDEMIIGTMQRCWQENH
YVLCPHSAVAAWYHYHAPLLGPAVSRCCIATASPAKFQEAVQKAGLTLDLPKELWALEEM
ETRYEKLEKGTDWEARLKERIRAIRCAREKGQVFYSAKK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggattatctcgtcaccctaatgtatcggttattggcaaaacatccacatcgtggaaca
cagttctggcagcgaactttttcaaaaggagcaatcatgcggtactgcagcacaagaggt
ggaacacgtggatgggacttccggcaagtactgttttcgggctatgctcccgatgggggg
atgtttatgccggagagtctgcctggcctctccgctgacaccctcaggtcctgggcctct
ctgtcctaccctgagctggtactggaggtgtgcgccttattcatccccgatgatctcata
ccgcgtcgtgacctagcagacttgctgcctcaggcactgtcggagttttcagtgccaggt
gctgtgcgcctggcgcagcttagggacggcctttgtgtgctggagctgttccacggtcag
acgatggctttcaaggacctggccatgacctgcgtcacccgcctgctcgattactttctg
cgcagagaacaccgtcgggccactattctcgtgggaacctcaggggacactgggggctct
gccatttgcagtgctcgtggcctggatggggtggacgtgctggttgtgtttcccctggga
cgtatcaccacagtacaggagaggcacatgaccaccagcctggaggacaatgtgcatgtc
tttgcggcggatggcagctctgatgacattgatgtcccactgagacgtctctttgctgat
caagacctggtcaaaaatcacggcctcatgagcttgaattctgtaaactgggcccgaatc
ctggtgcagctggcccatttcctttatgcatatttgcatttgagtgacctgcagaaggtc
aaaggtcaggaactgcctaccgtcgaggttgtggtgcccacaggaggtgctggaaacatt
gcagctggctgcattgtgaacctaatgggtgtgccgcttcgccttgttgccatggtgaat
aataatgacatcgtgcatcgggtggtgcaaagtggtgactattccatggcaagcagtgtg
aagcagaccctggctcctgccatagacattcaggacccgtacaacatggaacgtgtgctt
tggttgctgtctgataagaacagcgctttggtgaagggcctgatggaggagtttcagagc
tctcacagactgcagctgcctgaaaaactgcataaaaagctgtctgcattcatatcatca
ggctcagtcacagatgagatgatcattggtactatgcagaggtgctggcaagaaaaccac
tacgtcctgtgtccccacagtgctgtggcagcatggtatcattaccacgccccactgcta
ggtcctgcagtgagcaggtgttgcatagctacagcatccccggccaaattccaagaagcc
gtacagaaggcaggactgacccttgacctcccaaaggaattgtgggctctagaggagatg
gaaacacgctatgagaagttggagaagggcacagattgggaggccaggctgaaggaacgc
atccgagctataagatgtgcacgggagaaagggcaggtgttttactctgcaaagaaataa

DBGET integrated database retrieval system