KEGG   Paramormyrops kingsleyae: 111844029Help
Entry
111844029         CDS       T05788                                 

Gene name
blvrb
Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00740  Riboflavin metabolism
pki00860  Porphyrin and chlorophyll metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    111844029 (blvrb)
   00860 Porphyrin and chlorophyll metabolism
    111844029 (blvrb)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     111844029 (blvrb)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     111844029 (blvrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 Epimerase NmrA 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 111844029
NCBI-ProteinID: XP_023667873
Ensembl: ENSPKIG00000004671
Position
Unknown
AA seq 207 aa AA seqDB search
MAGTVKNVAIFGSTGLTGLATLPQAVAAGYNVTVLVRDPSKLPPDHRASRVVVGDVLNKK
DVEKTMEGQDAAIIILGTRNDLSPTTVMSEGTRNVLEVMKARGIRKVVACMSSFLLWDRA
KVPARLVPVTEDHDRMYRLLKESDLDYVAVMPPHIAGDKPLTENYTATENAVKSRVISKH
DLGHFFVKCLSTSDWNMKTVGVSGEYS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgggacagtcaagaatgtagcgatattcggttccacaggactgactggtttagct
accctgccacaggctgtggcggcaggttacaatgtgacagtgctggtaagggatccttct
aagttgcccccagaccacagagcgtccagggtggtggtgggtgacgtcctgaacaagaag
gatgtagagaagaccatggagggccaagacgctgccattattatactggggaccaggaat
gatctcagccccacaactgtgatgtctgagggaacaagaaacgtccttgaagtaatgaaa
gctcgtgggattcgtaaagttgtcgcatgcatgtcctccttccttctgtgggaccgtgcc
aaggtgcctgcccgcctggtgcctgttaccgaagaccacgacaggatgtacagactgtta
aaggagtcagacctagactatgtggcagtgatgcccccacacatcgcgggtgacaagccc
ttgactgagaattacactgcaactgagaatgcagtgaagagtcgtgtcatttccaaacat
gacctaggccacttttttgtgaaatgtctctccacctctgactggaacatgaagacagtg
ggagtgtctggagagtacagttaa

DBGET integrated database retrieval system