KEGG   Paramormyrops kingsleyae: 111848291Help
Entry
111848291         CDS       T05788                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04270  Vascular smooth muscle contraction
pki04371  Apelin signaling pathway
pki04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111848291
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111848291
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111848291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pki04147]
    111848291
   04031 GTP-binding proteins [BR:pki04031]
    111848291
Exosome [BR:pki04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111848291
  Exosomal proteins of colorectal cancer cells
   111848291
GTP-binding proteins [BR:pki04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    111848291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Roc MMR_HSR1 Gtr1_RagA AAA_24 FtsK_SpoIIIE MafB
Motif
Other DBs
NCBI-GeneID: 111848291
NCBI-ProteinID: XP_023675951
Ensembl: ENSPKIG00000008383
Position
Unknown
AA seq 398 aa AA seqDB search
MADFLPSQSFLNVCFPNCLLSSNEAEQLRKSKEIDKCLKRDKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGEDFDQRAKEEFRATIYSNVIKGIRVLVDAREKLHIPWGDPANQLHGE
TMMSFDTRSVQIAQGMVETKIFLQFLPSIRSLWSDSGIQNAYDRRREFQLGESVKYFLDN
AGKLGQLDYLPSQQDILLARKPTKGIHEYDFEIKNVPFKIVDVGGQRSERRRWFDCFDSV
TSILFLVSSSEFDQVLMEDRQTNRLKESLNIFETIVNNCIFSNVSIILFLNKTDLLEEKV
KIVAIKDYFPEYIGDPHNLADVQKFLVECFRSKRRDQQQKRQDQQQKRRHQQQKRRDQKQ
KPLYYHFTTAINTENIRLVFRDVKDSILHDNLEQLMLQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgtcccagtcctttctaaatgtatgtttcccgaactgcctcctc
agcagtaacgaggcagaacaactgaggaaatctaaggagatcgacaagtgcctaaaacgg
gataaaacgtacgtgaagcggctcgttaagatcctgctgctgggcgccggggagagcggc
aagtccactttcctcaaacaaatgcgcattatacacggggaggacttcgatcagcgggcc
aaagaggagttccgggctacgatatacagcaatgtaatcaaaggaatccgggttctggtt
gatgccagagagaaactgcacatcccctggggagatcccgccaaccagcttcacggggag
accatgatgtccttcgacacacgctccgtccagattgcgcagggcatggtggagacgaag
atcttcttgcagttcctgccctccatacgctcgctgtggagcgacagcggcatccagaat
gcctatgacagacggcgagaatttcagctgggtgaatctgtgaaatacttcttggacaat
gctggtaaactaggacagctggactatttgccttcacaacaagacatcctcttagctcgg
aagcctaccaagggtatccacgagtacgactttgaaatcaagaatgtgcctttcaagatt
gttgacgtgggagggcaaaggtcggagcgccggcgatggttcgactgctttgacagcgtc
acctccatcctcttcctcgtctcttccagtgagtttgaccaggtgctgatggaggaccgg
caaaccaaccggctcaaggaatcactcaatatctttgagactatagtcaacaattgcatc
ttcagcaacgtctccatcatcttgttcctcaacaagacggacctcttggaagagaaagtc
aaaattgtagccatcaaagactatttccctgagtacattggggatccccataatctggcc
gacgtgcagaagttcctggtggagtgctttcgcagcaagcgccgagaccagcagcagaag
cgccaagaccagcagcagaagcgccgacaccagcagcagaagcgccgagaccagaagcag
aagcccctctactaccacttcaccacagccattaacacagagaacattcgactggttttc
cgtgatgtcaaggactccatcttgcacgacaacctagagcagcttatgttacagtga

DBGET integrated database retrieval system