KEGG   Paramormyrops kingsleyae: 111848492Help
Entry
111848492         CDS       T05788                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00600  Sphingolipid metabolism
pki01100  Metabolic pathways
pki04020  Calcium signaling pathway
pki04370  VEGF signaling pathway
pki04371  Apelin signaling pathway
Module
pki_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111848492 (sphk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111848492 (sphk1)
   04371 Apelin signaling pathway
    111848492 (sphk1)
   04020 Calcium signaling pathway
    111848492 (sphk1)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111848492 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 111848492
NCBI-ProteinID: XP_023676335
Position
Unknown
AA seq 546 aa AA seqDB search
MDAKPDDSDRGRWGDDGEPLLYGEFTSAASRKVRYAVSLSDTALTTQRITAAPSGRGAAV
LNLRDCVGCRVFRAEDDADPGACFSAYFYPFKRRWMSSGAARQRVEQCFRVAPVQDPQVN
LREAERWAQAISQGSIRQRAPRQGGACAFRRTVCRQLLLLQLLSGRGQALSLFVGHVQHM
LTEASVPHTLLITERQNHARDLVREADLSQWDALVIMSGDGLLFEVVNGLMEREDWEQAI
QIPLGVLPGGSGNALAASILHYSGSQPVSSEELLVSCGFLLCRGLPSPLDLVSVSLASGT
RLFSFLSLAWGFVADVDIESEKYRYVGTARFTVGTLVRLASLRVYEGRLAYLPVEECPAP
CQASPPPHGLGICSSFFCHPPAGSSDPTATHTFHNSCNSNNSTKAEVPSSSSRGPPDSLL
VPLEQPVPSNWTVVKEENFVLVLAMYQSHLAEDFMAAPEAAADDGLIHLYYVRAGISRAA
LLRLFLAMEKGAHLSAGCPHLVYSKVRALRLEPLSPKGVITVDGEVVEYGPLQAQVHRGL
ARLIMG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaagccggacgattcggaccggggccggtggggcgatgacggcgagcccctg
ctgtacggggaattcacgtcggcggccagcagaaaggtcaggtacgcggtgagcctgagc
gacacggcgctcaccacccagcggatcactgcggcgccctccggccggggcgcggcggtc
ctcaacttgagagactgcgtgggctgccgggtcttcagggcggaggacgacgcggacccg
ggggcttgtttctccgcgtacttctacccctttaagcggagatggatgagctccggagcg
gctcgccagagggtggagcagtgctttcgggtggcgccggtccaggacccccaggtgaat
ctccgggaagcggagcgctgggctcaagccatcagccagggctccatccggcagcgagca
ccccgacaaggtggagcgtgtgcttttagaagaactgtttgcagacagctgctgctcctc
cagctgctgtccggccgcggtcaggcgctcagcctcttcgtgggacacgtgcagcacatg
ctgacggaggccagcgtcccccacacgctgctcatcaccgagcggcagaaccacgcccgc
gatctggtgagggaggcagacctgtctcagtgggatgccctggtcatcatgtcaggggac
ggactgctctttgaggtggtgaacggactgatggagcgggaggactgggagcaggccatc
cagattccactgggggttctgcccggtggctcggggaacgctctggctgcctccatcctc
cactactccgggtcccagccggtgtctagcgaggagctgctggtgagctgcggcttcctg
ctgtgccggggcctgccgtcgcccctggacctggtttctgtgagcctggcctcgggcacg
cgcctcttttccttcctctccctcgcctggggctttgtggccgacgtggacatcgagagc
gagaagtaccgctacgttggcacggcacgcttcaccgtggggacgctggtgcggctggcc
tccctgcgtgtctacgagggccggctggcctacctgcccgtcgaggagtgcccagccccg
tgccaggcctccccgcccccccacggcctcgggatctgctcctccttcttctgccaccca
cccgcgggctcgtccgacccgaccgctacgcacaccttccacaactcctgcaactccaac
aactcgacgaaggccgaagttccatcttcatcctccagggggccccctgactccctcctg
gtgccactagagcagccagtgcccagcaactggactgtagtgaaggaggagaactttgtg
ctggtgctggccatgtaccagtctcacctggccgaggacttcatggccgcgcccgaggcg
gctgctgacgacggcctcatacacctctactacgtccgagcgggaatctcccgggctgcc
ctgctgcgcctcttcctggccatggagaagggtgcccacctgtccgccggctgcccccac
ctggtctacagcaaggtgcgggcgctgcgcttggagcctctctcccccaaaggcgtcatc
acagtggatggagaggtggttgagtatgggcccctgcaggcacaagtgcaccgtggcctg
gcacgtctgatcatgggctag

DBGET integrated database retrieval system