KEGG   Paramormyrops kingsleyae: 111850184
Entry
111850184         CDS       T05788                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00230  Purine metabolism
pki00240  Pyrimidine metabolism
pki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111850184 (dck)
   00240 Pyrimidine metabolism
    111850184 (dck)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111850184 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 111850184
NCBI-ProteinID: XP_023679592
Ensembl: ENSPKIG00000018245
Position
Unknown
AA seq 264 aa
MATPPKRMCFSPVLDNSFEKRIKKISIEGNIACGKSTFVRMLEMESEDWEVIPEPIGRWC
NVQNTENEFEELTTSQKSGGNLLQMMYDKPSRWSYTFQSYACVSRVRSQLQKPSIKLQQA
EKPIQFLERSVYSDRYIFASNLFESGEMNETEWAIYQDWHSWLLSQFESKIELDAIIYMR
ADPERCMQRLHLRGREEEQGIPLEYLEKLHYKHESWLYHRNICVEFEYLKDLPVLVLDVN
DDFKHDKIKRAEVVDKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgacccccccaaagagaatgtgtttcagtccggtacttgacaacagttttgaaaag
aggattaagaaaatttctattgagggaaatatagcttgtggaaagtcgacgtttgtgcgt
atgttagaaatggagtctgaagactgggaggtcataccggaaccaatcggcaggtggtgc
aacgttcagaacacggagaatgagttcgaggagttgaccacctctcagaagagtggcgga
aaccttctgcaaatgatgtacgataagcccagccgttggtcctacaccttccagagttat
gcgtgtgtgagccgtgtgcgctcccaacttcagaaaccctctattaagctgcagcaggca
gagaaaccgatccagtttcttgagcgttctgtctacagtgaccggtatatctttgcatcc
aacttgtttgagtctggagagatgaatgaaaccgaatgggcaatataccaggactggcac
agctggcttctgtcacagtttgaatcaaagattgagcttgacgccatcatctatatgaga
gctgatccagagaggtgtatgcagcgtctgcatctgcggggacgagaggaggaacaggga
atccctctagagtatctggaaaagctgcattacaagcatgagtcctggctgtaccaccgc
aacatctgcgtggagttcgagtacctgaaggacctccccgtacttgtgctcgatgtgaac
gatgatttcaaacacgacaaaatcaaacgagcagaagttgtggacaaggtgaaggagttc
ctgagcacgctgtga

DBGET integrated database retrieval system