KEGG   Paramormyrops kingsleyae: 111850779Help
Entry
111850779         CDS       T05788                                 

Gene name
aplf
Definition
(RefSeq) aprataxin and PNK-like factor isoform X1
  KO
K13295  aprataxin and PNK-like factor [EC:4.2.99.18]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pki03400]
    111850779 (aplf)
Enzymes [BR:pki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     111850779 (aplf)
DNA repair and recombination proteins [BR:pki03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     111850779 (aplf)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     111850779 (aplf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCHH FHA_2
Motif
Other DBs
NCBI-GeneID: 111850779
NCBI-ProteinID: XP_023680796
Ensembl: ENSPKIG00000004644
Position
Unknown
AA seq 515 aa AA seqDB search
MPGFELEPVDGGGPIPLPQGETLLGRGPFLGVTDKRVSRHHGLLENNDGQLRIKPVCIPS
VTPSMNSYFTHANPCFWQSALEDLPRALEKDRWHPLHAGEIFSLLPGKYIYRVVSTKEEN
TQSNRQVLAEDETGKRSQEQNGLSDPGRPDTAERRTESAPSDFRREDDRARSPKQASTVD
SGIERPKAEERKRVLPAWMMQAAAFVQSPPTPKGGKRGRGKATPSQAKAPSSTPGGRRTA
CSGDETEQSETEHSLGQGRKKRKSSEDVQSPSTSKGVKWGGGTVTPSQAKTASSSQGGQR
AVSSGDESEEGGTEHFLGKVMKRKRSNEEDDTRSKASASFVTKARRPVRPIQAETSEESD
DPERPAGSNREPASGDEKKPDLVNRKEGPSQARNSQRVPCPYGNDCYRKNPIHFKECSHP
GDSDYEEKPADEDEDDRPECPYGTSCYRKNPLHKKEYKHTKDPAKRASRQEHADLDDDSF
MDDESESVDDDSDYVPYESDDSVNTKKQRKTLLRK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgccggggtttgaactggagcccgtggatggtggcggtcctatacctctaccccagggg
gaaacgctgctgggaagaggcccgtttcttggggtcactgataaaagggtgtccagacat
catggtctgctggagaacaatgatggacagctgcgcattaaacctgtatgcatcccatct
gtgaccccctccatgaactcctacttcacgcatgcgaacccctgcttttggcagtccgct
ctggaggatctcccacgggccctggaaaaggacaggtggcacccccttcacgcaggggaa
atcttctccctcctgccaggaaagtacatctatagggtcgtctccaccaaggaggaaaac
acacagagtaacaggcaagttctggcggaggatgagacgggtaagaggagtcaggagcag
aatggactgagtgacccaggaagacctgataccgcggagcggcgcacagagtctgcgccg
tcagacttcagaagagaggacgatcgcgctcgctctccgaagcaggccagcacagtggat
tctgggattgaacggccgaaggcagaagagaggaagcgggtgctgcctgcgtggatgatg
caagcggccgctttcgtccagagcccccccacacctaaaggcggtaagaggggcagaggg
aaggcaaccccatcccaagccaaagcgcccagctccaccccgggagggagaagaaccgcc
tgctcaggggatgagacagagcagagtgaaacagagcattcactcgggcaggggaggaag
aagaggaagagcagtgaagacgtccagagcccctccacctcgaaaggtgttaaatggggt
ggggggacggtaaccccatcccaggccaaaacggccagctcctcgcagggagggcaaaga
gccgtctcctcaggggatgagtcggaggagggtggaacagaacacttcctcgggaaggtg
atgaagaggaagaggagcaatgaggaagatgacacacgaagcaaggcctctgcgtcattc
gtgacgaaggccaggcgcccagtgaggcccatccaggcggagacgagcgaggagtccgac
gaccctgagagaccggctggaagcaacagggaacctgcttctggagatgagaagaagccg
gacttggttaacaggaaggagggtccctcacaggcaaggaattcacagcgagtcccctgt
ccctacggcaacgactgttacaggaagaaccccattcatttcaaagagtgcagccatcct
ggtgacagcgactatgaggagaagcccgcagacgaggacgaggacgacagaccagagtgt
ccgtatgggaccagctgctacaggaaaaacccactgcacaagaaagaatacaaacacact
aaggatccagctaaaagggcttcaagacaagaacatgctgatttggatgacgacagcttc
atggatgacgagagtgaatctgttgatgatgattcagactacgttccttacgagtctgat
gacagtgtgaacacgaaaaaacagagaaagactctgctcagaaagtga

DBGET integrated database retrieval system