KEGG   Paramormyrops kingsleyae: 111851209Help
Entry
111851209         CDS       T05788                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00562  Inositol phosphate metabolism
pki01100  Metabolic pathways
pki04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111851209
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111851209
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     111851209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX C2 PI3K_C2 DUF4135 PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 111851209
NCBI-ProteinID: XP_023681674
Position
Unknown
AA seq 1445 aa AA seqDB search
MDPSQEDTYWVQGRDSDSPLPLMDDLEMALAYRLGIFLDNNEQDIYNSVPVQHSKTVGPD
VPTRVQTAPLVPPPSDHQCNLPPVPPRPPKGDSAAACLARPPTLHEGGSSSKSALQDDWG
GNPPLPPRTRALSEQPVKHHRPLSCISIPSSNPPSRLGRANTTDDTGNWTLKLIDTAEEG
NDRLSAFRRSVSGLMQCYPYSDRTFNPGLVWGRISPFHPRLQEDDMVDISMTAAWLPHPV
PFTAPLNRTVRNLIEVLCFVLEATDADASQHLLKFCDSEEFLKNEEMLGMHESILTCQRL
RLQVSLRLLHQDHVKETLARDHEDDSCPFDIKHLLGSAFVFNTSRTALETHLKYYSKEIR
QLIQSQYGNNVVPIAEEVQTISSLLCGVSTRELEDAIGELQRTNHLRLVTHSVSDLYRVF
LEVTSYGEASVGWGSGAVLRAIAIAAYLILGPVVLRLDHALSRLLHTFFSNFDSDYRSEQ
PFRGPQPLSADVANNDEILQLDLAAFYKLEPSWIASLDYFCISCALTYGSKQLCEAALSE
NISTILSLGNKLQCSRKMSFPIQINSLPYESMLTFRLLGSKQGKTPELLRWAVLPLFADN
KLVSGTVLLSMSALEELTEPPTPGVSDSHRQATGVILQVEFPDTHRWVYKRPKSLACSLF
ITPPFEELHKKIVNVSQKHSVSFLTDNEKAFLWSKRHSCNKDNTYLHLLLSGAPQWTPED
LSEIYGILEHWPLRNPEEALLLLSDCFQDQNVRRVAVQRLEQLSDVELEGCLPQLVQALK
LEWNLNGPLILLLLSRSLQSVRMAHQLYWLLEDARETNKHYQSWYSKVQAGLRYCCGRQL
RQELENEHQLVKLLMAAAERIRMADKAKRKDILKHERIKMSDFFKGGVMCRLPLDPALLV
RGVDIEACKFYNSNAAPLGVAFINADSLGRNISIICKTGENLGQDMLVLQAVRAMDRIWL
ESGLDMRMVTYRCVATGRDQGLLEVIPKAVTLAQIQQEWGLRGPLREDTLEKWFHMWNRT
EEEYEEAVMNFLHSCAGWCVATFILGICDRHNDNIMLKHSGHMFHIDFGKIMGNAQKFGS
IKRDRCPFIFTSEMLHLITVGGKMAQRFQSFVELCCKAYNAIRRRCPVLLSLLELMTGAG
LPEMKNSQDLQYVYNNLRPQDSDLEAASYFTKMIKDSLCLSLPVKFNFLIHSFGQSLKAR
QPAQPVPSPHTNIQEAVIQKFSDKGRTVTYELHVKIEDGYLTCERTFSEFEMIHKELQKK
FVESLLPEFPGWYKLSFTASRRMTLLNKYLKELFNGPCKGNEVVCSLFLDGPKTHTAEES
KKDLAWPSKPQIQLCMTYKDLKLTILIKHLKNIRMPNGSCPDAYVVTRLRPDPGNCSKKK
TNMVRNSSNPTFNELIEYSDVQSLQGKVLELHVKSRGTFLAATNIWLADRRMGTDEWFPL
GSSSV
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggatccttctcaggaagacacctactgggttcaggggagggacagtgactctccgctg
cccctgatggatgacttggaaatggctttagcttacagattaggtatattcttagataat
aatgagcaagacatatacaactctgtcccagtccagcattctaagacggtcgggccagac
gtaccgactcgggttcagaccgctcccctggtccccccgccgtctgatcaccagtgtaac
ctgccacccgtacccccccgacccccaaaaggtgactctgctgcggcatgtctggcccga
cccccgacactccatgagggtggatcttcctctaaatctgctctccaggacgactggggt
ggaaatccacccctgcccccccgcactcgggccctcagcgagcagcccgtgaagcaccac
agacccctctcttgtatctccataccctccagtaaccctccgagtcgactcggccgagcg
aataccacagacgacaccggcaactggaccctgaaactgattgacacagcagaggagggt
aatgacagactttctgcatttcgtaggtcggtctctgggctgatgcagtgctacccgtac
agtgacaggacgttcaaccctgggctggtgtggggtcgcatctcacctttccatcccaga
ttgcaggaggacgatatggtcgacatcagcatgactgctgcgtggctgccacatccggtc
ccgttcacagcccctctcaacaggacggtgcggaacctgatagaggtgctctgcttcgtg
ctggaggccactgatgctgatgcaagccagcacctcctcaagttctgtgactctgaggag
ttcctcaaaaatgaggaaatgctaggaatgcatgagagcatcctgacgtgccagaggtta
cgcctgcaggtttcactcagactcctgcatcaggaccacgtgaaggagactctggcccgc
gatcatgaagacgacagctgcccttttgacatcaaacaccttttgggttctgcttttgtc
ttcaatacatctaggactgctctggagacccacctgaagtactacagcaaagagattcgg
caactcatccaaagccagtatggaaacaatgtggttccaatagcagaagaggtccagaca
attagcagtttgctgtgtggagtttccacaagagaactggaagatgccatcggtgaactc
cagagaaccaatcatctgagactagtaacacactccgtctctgacttatatagggtgttc
ctcgaagtgacttcttatggagaggcgtcagttggctggggttcaggtgcagtgctcaga
gcgattgcaatagctgcttatctcattttgggcccagtggtgctacggctcgaccatgcc
ctcagccggctgctgcacacgttcttcagcaactttgactctgattaccgaagtgagcag
ccattccgcggtcctcagcccctcagcgctgacgtggccaacaacgacgaaatcctccag
ctcgatctggctgccttctacaagctggagcccagctggatagcaagtcttgattacttc
tgcatctcatgtgccctgacctacggctcgaagcagctgtgtgaggctgcgctctcagaa
aacatcagcacaatcctgtctctgggaaacaagctacagtgcagcaggaagatgagcttc
ccaattcagatcaacagcctgccttatgagtccatgctgaccttccgtctgctgggctcg
aagcaggggaagaccccggagctgttgcgatgggctgtcctgcccctctttgctgacaac
aaacttgtcagtggcacagttctgctgagcatgtctgcactcgaagaactgactgaacca
ccaacacctggagtgtcagacagccacaggcaagccacaggagtcattctacaggtggag
ttcccagatacacacagatgggtgtataagagaccaaagtcactcgcctgctccttgttt
atcacccctccatttgaggagctacacaagaagattgtgaacgtgtcccagaagcacagc
gtgtccttcttgacagacaatgagaaggccttcctttggagtaaacggcactcgtgcaac
aaagacaacacctacctgcacctcctcctctccggcgccccacagtggacaccagaagac
ctgtcggagatctacggcattctggaacactggccactgcgtaacccggaggaggccctt
ctcctactcagtgattgcttccaggaccaaaatgtgcgcagggtggcagtccagcgtctg
gagcagctctcagatgtggagctggagggctgtctccctcagctggtccaggctctgaag
ctggaatggaacctgaatgggcccctgattctcctcctgctctcccgatccctgcagagt
gtccgcatggctcatcagctctactggctactggaagacgcccgggagacgaataagcac
tatcagagctggtatagcaaggtacaagccggactcaggtactgctgcgggcggcaactg
cggcaggaactggagaatgagcaccagctggtcaagctgctcatggcagcggcggagcgg
atccgcatggcggacaaggccaagaggaaggatatcttaaaacatgaaagaatcaaaatg
agtgacttcttcaagggaggggtaatgtgtcgcctgccacttgaccctgccctccttgtg
cggggtgtggacatagaggcctgcaaattttacaactccaatgcagctcctctgggagta
gcctttatcaacgcggacagtctgggcagaaacatttccatcatctgtaagactggcgag
aacttgggccaggacatgctggtgctgcaggcagtccgtgcgatggaccgcatttggctg
gagagtggcctggatatgcgcatggttacttacaggtgtgtcgccactggaagagaccaa
ggactgctagaggtcattcctaaggcagtgaccctggcgcagatccagcaggagtggggg
ctccgtggccccctgcgggaggacactctggagaagtggttccacatgtggaaccgcacc
gaggaggagtatgaggaggctgtgatgaacttcctgcattcctgtgcgggctggtgtgtg
gccaccttcatcctgggcatctgtgaccggcacaacgacaacatcatgctgaaacacagc
gggcacatgttccatatcgacttcggaaaaatcatgggcaacgcccagaagttcggctcc
atcaagagagaccgctgtccattcatcttcacgtccgagatgctgcacttaatcacggtt
gggggcaagatggcgcagagattccagagcttcgtggaactctgctgcaaggcctacaac
gccatccgcaggcgctgccctgtactgctaagcctcctggagctgatgactggagctggg
ttacctgagatgaagaacagtcaggatttgcagtatgtctacaacaacctccgacctcag
gattctgacctggaagctgcatcatacttcactaagatgattaaggacagcctttgcctg
agtctgccagtcaagttcaacttcctgatccacagcttcggccagtccctcaaggccagg
cagccggcccagccagtgcccagcccccacaccaacatccaggaagccgtcatccagaag
ttctcagacaaaggcagaacagtaacatatgagctccatgtgaaaatcgaggatggttat
ctgacctgcgagagaaccttcagcgaatttgagatgatccacaaggaacttcagaaaaag
tttgtggagtccttgctcccagagttccctggttggtacaaactgtctttcactgccagc
aggagaatgactctgcttaacaaatatctgaaagagctctttaatggtccctgcaaaggc
aatgaagttgtgtgcagtttgtttcttgatggtcccaagacacatacagcagaggaatcc
aaaaaagacctggcctggccgagcaaacctcagatccagctgtgtatgacctacaaggac
ctcaagctaacgattctcatcaagcatctcaagaacattaggatgcccaatggctcttgt
cctgatgcctacgtggtgacacgactgcggccggacccggggaattgctccaagaagaag
acgaacatggtgcggaacagcagcaaccccacgttcaatgagctgattgagtacagcgac
gtccagtcactccagggcaaagtactggagctacatgtgaagagcaggggcacctttctg
gctgcgaccaatatttggctggctgacaggaggatgggcacagatgaatggttcccatta
gggtcctccagtgtctga

DBGET integrated database retrieval system