KEGG   Paramormyrops kingsleyae: 111852979Help
Entry
111852979         CDS       T05788                                 

Gene name
h6pd
Definition
(RefSeq) GDH/6PGL endoplasmic bifunctional protein
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00030  Pentose phosphate pathway
pki01100  Metabolic pathways
pki01200  Carbon metabolism
Module
pki_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pki_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111852979 (h6pd)
Enzymes [BR:pki01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     111852979 (h6pd)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     111852979 (h6pd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 111852979
NCBI-ProteinID: XP_023685144
Ensembl: ENSPKIG00000000427
Position
Unknown
AA seq 791 aa AA seqDB search
MMWRPLLTFLLLDSVCTQKGSSKELKGHVSVVIVGGTGDLAKKYLWQSFFQLYADQVSSG
YSFSFYGGGLSEAEKGKPKFFQILKSLACPSEGSEERCALLKEQFFKLAQYQQLNTTEDY
ENLARDIRQRPEDEGLAEAGRLFYLAVPASTYADVAEKISRSCRPGQGQWLRVVLEKPFG
HDLDSAEQLATLLKKSLHEDEMFRIDHYLGKQVVSQILPFRKDNKNFLDPIWNKHHIERM
EIVLKETLDVKGRAQFYDQYGVIRDVLQNHLTEVLLLLTMGVPADMSNSDEIVNKKLQVF
SSLKDIDRTSAVIGQYQAYNSEVQEELNRTKEDISNTPTFAGVVVHVRNTQFDGVPIFLT
SGKMLDEQVAYARILFKNEVFSVRNSSSLRCSPKQIVFLLRHGNLLHSAILVSKNLFKPT
VPDDSWKEVTGERDTALFGLPLSGYHIYMPTFQREAHEVVVSQIFHGRKDSIIRVETMLA
SWAFWTPLLDSLAQQVPRTYPGGTDTENLLDFQLHGRKITFTNEAVILSPRAFVGGSATA
ENFQVMRGKYRNADMVSAWPEELIDRLAADLQAAAEEAVEGGGLFHLALSGGSSPLALFQ
RLAVHHYSFPWQHTHIWMVDERCVPLSEPGSNFHALHEDLLQHVRLPYFNIHPMPVHLNR
RLCVEEDGGPLLYENDISRLVNGSSFHFVLLGVGYDGHTASLFQSTQLDSHAHRLVVLTE
SPVKPHQRMSLTLAAINQAQRVGVLVTGKSKHEMIIQLSRIKDDPQKWPITGVRPTGGKL
VWYIDYDALLG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcggccattgttgacctttttgctactggacagtgtatgtacacagaagggc
tccagcaaggagttgaaaggccatgtgtctgtggtcattgtgggtggcacgggcgatttg
gccaagaagtacctttggcaaagcttcttccagctgtatgctgatcaggtcagcagtggg
tacagcttttccttctatggcggcggcctttcagaggctgagaaaggcaagcccaaattc
tttcagattctgaagagcctggcgtgcccgtcggaggggtcggaggagcggtgtgctctg
ctgaaggagcagttcttcaagctggctcagtaccagcagctgaacaccacagaagattat
gaaaatctggcacgagacatcagacagcggccagaagatgaaggcctggcggaggcgggc
cggctgttttacctggccgttcctgcgtccacgtatgctgatgtcgcggagaagatcagc
cgcagctgtaggcccggccaggggcagtggcttcgggtggtgctggagaagccgttcggc
catgacctggacagtgctgagcaactagccacgctgctgaagaagtctctgcacgaggac
gagatgttccggatagaccactacctaggaaagcaggtggtttcccagatattgccgttt
cggaaagacaacaagaacttccttgaccccatctggaacaaacatcacatagagcgaatg
gagatagttctgaaagaaactctggatgtaaaaggcagggctcagttttatgatcagtat
ggggtgatcagggacgtgctgcagaaccatctgacggaggtccttctccttctgacaatg
ggagtcccagccgatatgagcaacagcgatgagattgtcaacaagaagctgcaagtcttc
agctctttaaaggacatcgaccggactagtgctgtcattggtcaataccaggcctacaac
tctgaggtgcaggaggagcttaacaggaccaaggaagacatcagcaacacacccaccttt
gcaggtgttgtggttcatgtcaggaacactcagtttgatggagttcctatcttcttgacc
tctgggaagatgctggatgagcaggtggcctatgcccgcatcctcttcaagaacgaggtc
tttagtgttcggaattccagcagtctccgatgtagccccaagcaaatagttttcctcctg
agacatggtaacctactgcactcggccattctcgtcagcaagaatctcttcaagcctact
gttccagatgatagctggaaagaggtgacaggagagagagatactgccttgtttggcctg
cccttgtcaggttaccacatctacatgcccacgttccagagggaggcccatgaggtggtc
gtctcccaaatctttcatggcagaaaggacagcattatccgagtagaaaccatgctggct
tcctgggctttttggacacccctattagacagcctagcacagcaggttccgcgcacatat
cccggaggcactgacacggaaaatcttctcgacttccagctgcatggcaggaagattacc
ttcacaaatgaagctgtaatcttgagcccacgtgcctttgttggggggtcggccacagct
gagaacttccaggtcatgcgcggcaagtaccgtaacgcagacatggtgtcagcctggccg
gaggagctcatcgatcgactcgccgccgacctgcaggccgcagccgaagaggcagtggag
ggtggtggacttttccacctggcgctgtccggaggctccagccccctcgccctgttccag
cgcttggctgtacatcactactccttcccgtggcagcacacgcacatatggatggtggat
gaacgttgtgtgccattgtcagagcccggctccaacttccatgccttgcacgaggacctt
ctacagcatgtacggctgccctatttcaacattcatcctatgcctgtacacctcaatcga
cgtctttgcgtcgaggaggacggcggcccgctgctctacgagaatgacatctcccgattg
gtcaacggctccagttttcactttgttctactgggtgtaggttatgatggacatacagct
tcactcttccaaagcactcagctggactcccatgcgcacaggctggtggttctgacggag
agcccggtgaaaccacaccagcgcatgagccttactctagctgccatcaatcaagctcag
agggttggtgtactggtgacgggtaaaagcaaacatgagatgatcattcagctgagccgg
ataaaggatgatccacagaagtggcccataacaggtgtcaggcctactggtggcaagctg
gtgtggtatatcgactatgatgctctattaggctaa

DBGET integrated database retrieval system