KEGG   Paramormyrops kingsleyae: 111853000Help
Entry
111853000         CDS       T05788                                 

Definition
(RefSeq) titin-like isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111853000
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pki04131]
    111853000
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pki04812]
    111853000
   04147 Exosome [BR:pki04147]
    111853000
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111853000
Protein kinases [BR:pki01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111853000
Membrane trafficking [BR:pki04131]
 Others
  Actin-binding proteins
   Others
    111853000
Cytoskeleton proteins [BR:pki04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111853000
Exosome [BR:pki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111853000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig C2-set_2 DUF4198 C1-set Ig_6 BTD
Motif
Other DBs
NCBI-GeneID: 111853000
NCBI-ProteinID: XP_023685183
Position
Unknown
AA seq 2257 aa AA seqDB search
MSTEVPTFIQPLQNIVALEGTAASFEAHVSGTPVPEVSWFRDGQVLSATALPGAQISCSD
GHAVLTIPDVSAAHSGRFSVRATNCVGQATSTAELVVTVFSVFINPSAAETIPPNFIQKL
QSVTVKQGSQVTLAVRVTGTPTPVVKFLHDGNEIQSSRDFCLFHDGDLYSLVIAEAFPED
SGMFSVSATNSSGQATCTAQLLVQGEEEAILSKQTITVISSEKIFQEQQASVIKVEDSKS
ELSLTEAASKPPAIVIGLNDTTITEGESVTLECQISGCPIPSVVWFREEYEIKSSSDFYL
LYENGCARLVIREAFAEDSGHFTCTASSQTGSVSTSCFLTVKASEEAEIKEAMGNTSVSK
HIETEEMHVTMEAKTHAISEVNGLVESEEGMAPFFVTKPSVQRLVEGRAVDFECQIGGSP
QPHIYWKKAGVPLSNGFRHKILHEKESGLCRLQISMMLADDAGHYVITARNRFGEASASA
ILLKEEEYEALSRQHRLISGGQAVSLVYETKGRETTPMVMGEVQKRQVLMQKRTVQQTQE
FHISAFEERIIQEIELGILQSNYQELVTEDGEEMVMNVSEQEAMKPTLDMPVKSQRMVEG
TRVTFQCIVAGSPLPKIAWYKDGRRIRHSDHYQTEVLQDGIVSLHLPVVLPEDEGIYTVL
ASNVNGNAISSGKLQVELSAASVARPFAPQAAAVKPVCSTSPPPVSRSSEYILEENNEGE
MERMYRPIFVMKPSSLRCTEGQTARFDVKVVGSPMPETFWFHNGKPVCNDYTHKMVVKED
SVQSLIVVPALPEDSGEWSVIAKNRFGQSSITMSLTVEAKEIISQPRFVEKLKNISVKDG
ASIEFSIKATGNPLPDIAWLKNSDIISTYKYPNFRIEGTKGESKFMISPTTALDSAWYTA
IAVSKAGRDTTRFKVNVKVEFSQPTPEKRLIIPKGTYKAKEIAPPELEPLPIRYGQEQWE
EGDLYDMKKQQKPHFKKKLSSVRLKHFGPVHFDCRLIPIGDPNMTVEWLHDGQPLAAANR
LRMTNEFGYCSLDYEVAYSRDSGIITCKASNNYGADHTSATLIVKDEKGLVEETQFPEGI
KGKHRIEEIERVSHEGPSGVTDDEVSEKAKPEIVLLPEPAVVLEGDTARFRCRVTGYPVP
KVNWYLNKQLIRKSKRFRLRYDGIYYFEISDCKSYDAGEVKVMAENPVGVVEYCVKLEIN
QRKDFRSILRRAPELKSPETGPTPEQGGLPFTVIKIEEPPETTQTKETVKLKKTERVIHE
ITTEETEELKNKFKRRTEEGYYEAISALELKSHKKDESYEDMLKKRKGELLHRTKEVSDK
DKVEEQDTRTVSVTRTEKVLLDPSMKAPKIVDRIQSQTVSEGEEAHFRVIVDGEPAPDCQ
WYKNGIVLEKSERINWYWPEDKVCELVIKEVSAADSASIMVKAVNIAGETSSHTFLLVQA
KHVITFTQQLEDATAKEKDTMVTFECETSEPFVKVKWLNGNEEIFPSNKYRMHSDRKVHF
LSVLSIHTSDTAEYSCAVADADHIRTSAWLTVEGSPLDILKNLDNLEIPESYTATFECEM
SREDVEGTWYFDDMEISPSTKYIISSRRGRYSLSVKDVRREDQGEYTFVVGELMTTGKLK
MKLRPVTLMQGLSDLTICEGDNAELEVKLSQENIKGTWLKNGQAIDTTGHVRLVTDKLTL
KLVIEAADRDDSGIYSFTVSDQDISTSARLTVQTISILTPLEDVATVEGTKAVLEAKISA
ADVSFVKWYHDGELVMPSERVQWIAKGSKQRLVFSRTFASDEGHYRLAVGNTGSECHLTI
ENIDILRSMEDQVCAETQNVTFEVELSHPGIDAVWTFNNQQLKAGAKYKIESAGQSYTLT
IVMAMKDEEGVYMFAAGEQTCSARLTVSGGAIKRPLQDVVVAESQLAELECEVANPSAEG
LWLKDGQHVFFSDNIRSQDVGELRRLVIIITRPQDVGEYTYQLGNSKTTAHLKVEAVKIK
KTLKNQAVLETQDAVFGLELSHEDMKGSLWTKNGVEIQPSDKFDMRIDGAVHTLVIKSCT
TQDEAVYGLKLGKLFANARLSVEMVKILKKPKDVTALKGGTASFELGLSHNDIPVKWMFN
NVELMPSEKCTILYEKKVHKLVINVVDSHDAGEYTAVVGHLYCNASLSIDILSITKAMKN
IEVAESKTAIFECEVSHVNMPFAWLKADMEIEPSEKYGIGVQDKVYQLKIMNISQEDAGE
YTFFYGEDCLVSATLTVTRKTKDRTSKAQGKESVAEC
NT seq 6774 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagaagttcccacattcatacagccactgcagaacattgtggctctggagggc
acagctgcgtcctttgaggctcatgtcagtggtaccccagttcctgaggtgagctggttt
agggatggccaggtcctctctgccacagctctgcctggtgcacaaatctcatgcagtgat
gggcacgccgtgttgacaatccctgatgtgtcagccgcacacagtggacgcttttctgtg
cgagccacaaactgtgttggccaggctactagcacagctgagctggtggtcacagtgttt
tccgtgtttataaatccctctgcagcagaaaccatcccacccaacttcatccagaagctg
cagagcgtgacggtcaaacaaggtagccaggtgacactggcggtacgtgtcacagggacc
cctacacctgtggtgaagttcctccacgatggaaatgagattcagagctctagggacttc
tgccttttccatgacggagacctttacagtctggtcattgctgaggctttcccagaagat
tctggaatgttctctgtcagtgccaccaatagcagtggccaggctacttgtacagcgcag
ttactggtgcaaggtgaagaagaagccattctttccaagcaaactatcactgtcatttca
tctgagaagatatttcaagaacagcaagctagtgttataaaggttgaagactcgaagtca
gaactgtccctgacagaagctgcctcaaagccaccagccattgtaattggcttgaacgac
accaccatcaccgaaggagaatctgtgactctggaatgccagatttctggctgccccatt
cccagtgtggtgtggttccgcgaggagtatgagatcaagagctcctctgacttctacctt
ttatatgaaaatggatgtgcccgcctggtgatccgtgaggccttcgctgaggacagcggc
cacttcacctgcactgcaagcagccaaaccggctctgtgagcacctcctgcttcctcact
gtcaaggcatcagaggaggctgagatcaaagaagccatgggtaataccagtgtctctaag
cacattgagactgaagagatgcacgttaccatggaggccaaaactcatgccatatctgag
gtgaatggattggtggagtcagaggagggcatggccccattctttgtgacaaagccatcc
gtgcagaggttggtggagggcagagccgtggactttgagtgccaaattggtggtagccca
cagccccatatttactggaagaaagctggagtacccctgagcaatggattcaggcataaa
attctccatgagaaagagtccgggttatgcaggctgcagatttccatgatgcttgctgac
gatgctggacactatgtcatcacagcccggaaccggtttggagaggcctctgcctcagcc
atcctgctcaaggaagaggaatatgaagcgctcagcaggcaacacaggctgatctctgga
gggcaggcggtgagccttgtgtatgaaaccaaagggagggaaaccacccccatggtcatg
ggggaggtccagaagaggcaagttctcatgcagaagaggacagttcagcagacacaggaa
ttccacatctctgcttttgaagagaggataatccaggagattgagctaggtatccttcaa
agcaactatcaagagctggtgactgaggatggagaggagatggtgatgaatgtgtccgag
caagaggccatgaaacccacccttgacatgccagtgaagagccaaaggatggtggaagga
acaagggtcaccttccagtgcatagtagctggatctcctctgcccaagattgcctggtac
aaagatggcaggcgcattcgtcatagtgaccactaccagactgaggttctgcaggatgga
atagtcagcctccatctccctgtggtactacctgaagatgagggcatctacacagtgctg
gcgtccaatgtgaatggaaatgccatcagctccgggaagctccaggtggagctcagcgca
gcaagtgtggctcggccatttgcccctcaggcagcagctgtcaagccagtctgctccaca
tctcctcctcctgtgagccgctcctctgaatatatactggaggagaacaatgagggtgag
atggagaggatgtaccggcccatatttgtcatgaagccttcctccctccggtgtaccgag
ggacagactgcgaggtttgatgtaaaagttgtgggtagccctatgccagagaccttctgg
tttcacaatgggaagccagtgtgcaacgactacacacacaagatggtagtaaaggaagac
agtgttcagtcactgattgtggttccagctcttcctgaggactccggggaatggtctgtc
atagccaagaacagatttggtcaaagctcaatcaccatgagtctcaccgtggaggctaaa
gaaattatttcgcaacctcggtttgttgagaagctgaagaacatcagtgtcaaggatggt
gcatccatcgagttttccattaaagctactggaaaccctttacctgacattgcttggctt
aaaaacagtgacataatttccacttacaagtacccaaatttcaggattgaaggcacaaaa
ggagaatctaaatttatgatcagcccgaccacggccctggacagtgcctggtacacagct
attgctgtcagcaaagcaggacgggacaccacccgtttcaaggttaacgtgaaggtggag
ttcagtcagcccacacctgaaaagaggctcatcatcccgaagggtacctataaggcaaag
gagatagcccctccagagctggagcctctgcctattcgctatggacaagagcaatgggag
gagggagacctgtatgacatgaagaagcagcagaagcctcacttcaaaaagaagctgtca
tcggttcggctgaagcactttggtcctgtgcactttgactgcaggttaatccccatcggc
gaccccaatatgacggtggaatggctgcatgatggccagcctcttgcagcagcaaacagg
ctgcgcatgaccaatgagtttggctactgcagccttgactatgaagtggcttattctagg
gatagtggcatcatcacctgcaaggcttcaaataattatggagcagaccacacctctgcc
accttgattgtgaaggatgagaagggtcttgtggaggaaactcagttcccagagggcata
aagggaaagcataggattgaggaaattgagcgtgtttcccatgagggtcccagtggtgtc
actgatgatgaggtatcagagaaagctaaacctgagattgtacttctcccagagccagca
gtggtgctggaaggagacacggccaggttccgctgcagagtgactggttacccagtccca
aaggtaaactggtacctcaacaagcagcttattcgtaagagcaaaagatttaggctccgc
tatgatggtatttactactttgagatttctgattgcaagtcttatgatgctggagaggtt
aaagtaatggctgagaatcctgtgggtgtagtagagtactgtgtgaaactggaaatcaac
caaagaaaggacttcaggtccatcctccgtcgagcccctgagctgaagagtcctgaaact
ggtcccacccccgagcaaggtgggcttcccttcacagtcatcaaaattgaggagccccct
gaaacaacccagacaaaagaaactgtcaaactgaagaagactgagcgagtcatccatgag
atcaccacagaagaaacggaagagctgaaaaacaaatttaagcgcagaacagaagaaggc
tattatgaagctatttctgccttagagcttaaatcacataaaaaagatgaatcctacgaa
gacatgctgaagaagagaaaaggagaacttcttcaccggaccaaagaagtgtctgacaaa
gataaggtagaggagcaagacacaaggacagtttcagttaccagaacagaaaaggtactg
ttagatcccagcatgaaggctcccaaaattgtggatcgcatccagagccaaactgtttcc
gagggagaagaagctcacttcagagttatagtagatggggaaccggcccctgactgccag
tggtacaagaatgggatagtgctggagaaatctgagcgcattaactggtactggccagaa
gacaaggtgtgtgagttagtaattaaagaagtttcagctgctgactctgcaagtatcatg
gttaaagcagtcaacatcgctggggagacttcaagccacacgttcctgcttgtgcaagcc
aaacatgtcattacattcactcaacaactagaagatgccactgccaaagagaaggataca
atggtgacctttgagtgtgaaaccagcgagccatttgtcaaagtgaagtggctgaatggc
aatgaagagatcttccctagtaacaaataccggatgcactctgaccggaaggtgcacttc
ctctctgtgctcagcattcacaccagtgacactgcagagtacagctgtgctgtggctgat
gctgaccacatcagaacttctgcctggctcactgtcgagggttccccactggatattttg
aagaatctggataatttagaaattccagaatcttacacagcaacctttgagtgtgagatg
tcacgtgaagatgtagagggcacctggtactttgatgacatggagatctcccccagcacc
aaatacatcatatcctctcggcgtgggaggtacagcctctcagtcaaagatgtgaggagg
gaggaccagggggagtacacgtttgttgtgggtgaactgatgacaactggcaagctgaag
atgaaattgcgtcctgtgacacttatgcaaggcctctcagatctaaccatctgtgaaggt
gacaatgctgaattggaagtgaagctctctcaagagaacattaagggcacctggttgaag
aatggccaagccattgataccactggccatgtccgcttggtgactgacaagctcactctc
aagcttgtcatcgaagcggctgacagggatgacagtggaatatattcctttactgtttct
gaccaggatatctccacctctgcaagactgactgttcagacaatcagcatcttgacccca
ctagaggacgtggccacagttgagggcaccaaggctgttctggaggctaaaatctctgct
gctgatgttagctttgtgaaatggtatcatgacggtgagctggtaatgcctagtgagaga
gtgcaatggattgccaaggggtccaagcagcgtctagtcttcagcaggacgtttgcctct
gatgaaggtcattacagactggctgtaggaaacactggaagcgagtgtcacctgactatt
gaaaacatagacatcttgaggtcgatggaggaccaagtgtgtgcagaaacccaaaatgtc
acctttgaggtggagctgtctcatccaggcattgatgctgtgtggaccttcaataaccag
cagcttaaagctggtgcaaaatacaaaatagaatctgctggccagagctacaccctaaca
attgtgatggccatgaaagatgaggaaggggtgtacatgtttgctgcgggtgaacagacg
tgcagtgcaagacttactgtttctggcggtgctattaagaggcctcttcaggatgtggtg
gttgcagagtcccagttggctgagctggagtgtgaggtggccaaccccagcgccgaaggc
ctgtggctgaaggatggccagcacgtgttcttcagtgacaacatacggagtcaggatgtt
ggggaactcaggcgccttgtcatcatcatcactaggcctcaggacgttggggaatacacc
taccagctgggcaactccaaaacaaccgctcacctcaaagtcgaagctgtgaagatcaag
aagactctcaagaaccaggcggtgcttgagacccaggatgcagtatttggtctagagctc
agtcacgaggacatgaaaggttccctgtggaccaaaaatggagtggagattcagcccagt
gacaagtttgatatgaggatagatggtgcagtccataccctggtgatcaagagctgtacg
acacaagatgaggcagtctatggattaaaactcggaaagctctttgcaaatgccagactt
agtgttgagatggtaaagattctgaagaagcctaaggacgtgacagctctgaagggtggc
actgcatcctttgagctgggcctctcgcacaacgacatccctgtgaaatggatgttcaac
aatgttgagctaatgcccagtgagaaatgtaccatcctgtatgagaagaaggtccataag
ctggtcattaatgttgtggattcccatgatgctggggagtacaccgctgtggtgggccat
ctctactgcaacgcttcgctcagcattgacatcttaagtataacaaaagccatgaagaac
attgaggtggctgagagcaagacagccatttttgagtgtgaagtatcgcatgttaacatg
ccattcgcatggctgaaggcagacatggagattgagcctagtgagaaatatgggattggt
gtgcaggataaggtctaccaactcaagatcatgaatattagccaagaagatgcaggagag
tacaccttcttctatggagaagactgtttggtctcagctactttgacggttacccggaaa
acaaaggacaggacatccaaagctcagggcaaggaaagtgtggcagaatgctga

DBGET integrated database retrieval system