KEGG   Paramormyrops kingsleyae: 111854445Help
Entry
111854445         CDS       T05788                                 

Gene name
rassf5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pki00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111854445 (rassf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 CaKB
Motif
Other DBs
NCBI-GeneID: 111854445
NCBI-ProteinID: XP_023688160
Ensembl: ENSPKIG00000004634
Position
Unknown
AA seq 423 aa AA seqDB search
MASATVIYCEGWTANVGKSSQTRSRRSLVWKRESALSASPASLDHLPGHRAVPSDATPSS
CISQSRNEAGMIGEEFFSHEKMTARPSSQITVHRDLDLSFLCGGGGWSAGDRVTQGRSGV
VRKKSDPPRREAWSIFSQEDPRVKKEKGEGHVFVVKKVEQDWCDACNCRVSGSALKCRNC
TYTCHLQCKDLVQLDCNQCDTQSEASLPHRRAPPQPQDKSEGKEEDHEPKSLSEITARIA
EYNSKATENGMKLNEDGVYTGFIKVQLKLRRPVTVPGGGADAVEKTSFYLPSDAVKQLHI
SSSTTVDEVIQGLLTKFMVLDNPRKFALYRQMHRDGQDLFQKLAISEHPLYLRLIAGPDP
ECLTFVLKENETVEVEWHAFSVPELHNFLMILGREEEERVRQVQKKYGEYREKLQEALNG
KLG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcaaccgtgatttactgcgaagggtggacggcgaacgtgggcaaatcgtct
cagacgagatcaaggcggagcctggtatggaagagggaatccgcgctgtcagcatcgccg
gcatccttagatcaccttcccggccaccgtgcggtgcccagtgatgcgacgccgtccagt
tgcatctcccagtcgcggaatgaggcgggcatgattggggaagaattctttagccatgaa
aagatgacggccaggccctcgtcccagatcacggtgcaccgggacctggacttaagcttc
ctgtgcggcggcggcggctggagcgccggggaccgggtgacgcagggcaggtctggggtg
gtcaggaagaagagtgatccgcccaggagagaagcgtggtcgatcttcagccaggaggac
ccgcgagtgaagaaggagaagggagaggggcatgtgttcgtcgtgaagaaggtggagcag
gactggtgcgatgcttgtaactgccgagtgagcgggagcgcactaaagtgtcggaactgc
acctacacctgtcacctgcagtgcaaggatctcgtccagctggactgcaaccagtgcgac
acacaatcggaagcctccttaccccaccggcgtgcgcccccccagccccaggacaagagt
gaagggaaagaagaggaccatgaaccaaagtcactctcggagatcacagccaggattgcg
gagtacaactccaaggcaactgagaatgggatgaagctgaatgaagatggtgtttacacg
ggcttcatcaaggtccagctgaagttacggcgccctgtgaccgtgcctgggggcggggct
gacgccgtggaaaagacctccttctacctgccgtcggacgctgtcaagcagctgcacatt
agcagcagcaccacggtggatgaggtcatccagggcctgctgaccaagtttatggtgcta
gacaacccgcgcaagtttgcactgtaccgccagatgcaccgcgatggccaggatctcttt
cagaagctggccatttcagagcatcccctgtaccttcggctgattgccggcccggaccct
gagtgcctgacctttgtcctgaaggagaacgagacggtggaggtggagtggcacgccttc
tcggtgcctgagctacacaacttcctgatgatcctggggagggaggaagaagagcgtgtg
cggcaggtgcagaagaagtacggggagtaccgggagaagcttcaggaggcgctgaatggc
aagctgggctaa

DBGET integrated database retrieval system