KEGG   Paramormyrops kingsleyae: 111854986
Entry
111854986         CDS       T05788                                 

Definition
(RefSeq) uncharacterized protein LOC111854986 isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pki03000]
    111854986
Transcription factors [BR:pki03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111854986
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 111854986
NCBI-ProteinID: XP_023689300
Ensembl: ENSPKIG00000001317
Position
Unknown
AA seq 681 aa
MYKQSTCYLNGRYIMIPPGDCMYAGRKRRKPIQKQKPAAVNEKSNPSKRHRDRLNAELDR
LASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQAIQEKPSRTHVSPSTNSDLGKESLP
GETSITESELLLESLTGFALVVSTEGMVFYASSTIVDYLGFHQTDVMHQNIFDYIHVDDR
QEFRRQLHWAMNPSQQLPAPDHPLVAGSGEDFAVSSLFSCDESGNIPGQFSSFLNRCFIS
RVRCLLDSTSGFLTMQFQGRLKFLHGQKKKTPSGSPLPPQLAFFCVAIPLLLPSITEMKM
KSVAMRGKQRGGLLTALDHNEREEQLRKTSSGGTMSHGGDVLLLSCSGNPAGGSRHHATP
WMALAKDAKHKSEAYFAQEEPLNFCKSPAAGQRGPGLEHSAWAVRVGQGVAFPPGRLGRL
SQYGRPGVYRTSSGCHGNRNDYLSKPYGDGSLNAEMESYCVEGIKSENGYLAAEEGYSGR
VLLEMPIKVEQDSDSENGCDAYGFSHGRSWPCKEHAERRYATTYDGLQLKTEADYFEQYS
PCQKGKVGAGPAFNGHYQNACVQENRPLKCVLNKELTQFCQQRLSHSDPLCSNQSANCME
SHMFTGGADSLDHKGYANQDYKFGYDFKGHGLLHSIKREPMDSPPWSDSGHDLDHVAVHR
NIMSNCVMTAAHKSNPYIYMQ
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgtataagcagagcacctgctaccttaacggtcgctacatcatgattccgccgggggac
tgcatgtacgccggcagaaaacggagaaagcccatccagaaacagaaaccggcggcggtg
aacgagaagtcaaacccgtcaaaacggcaccgtgaccggctgaatgccgagctggaccgg
ctggccagcctgcttccgttccccccggacatcatctccaagctggacaagctttcggta
cttcggctcagtgtaagctacctgagggtcaagagcttcttccaagccattcaggagaaa
ccttccagaacgcatgtcagtccatccaccaatagtgacctggggaaggagagtctgccg
ggagaaacgagcatcacagagagcgaactcttattggagtccctgaccggcttcgcactg
gtggtgagcacagaggggatggtcttctacgcttcctctaccattgttgactacttgggc
ttccatcagactgatgtgatgcaccagaacatcttcgactacatccatgtggacgaccgg
caggagttcagaagacagctccactgggccatgaaccccagccagcagcttccagctcca
gatcaccccctagtggcagggagcggtgaggactttgcggtgagcagcctcttcagctgt
gacgagtcgggcaacatcccggggcaattctcctccttcctgaaccgctgctttatctct
cgcgtccgctgcctgctggacagcacgtccgggttcctgaccatgcagtttcagggccgc
ctcaagttcctgcacggacagaagaagaagacgccgtcggggtcgccgctgcccccgcag
ctggcgttcttctgcgtcgccataccattgctgctgcccagtatcaccgagatgaagatg
aagagcgtggccatgagggggaagcagaggggcggcctcctcaccgctctggatcacaat
gagagagaggagcaattgcgaaagacttccagtgggggcacaatgagccacggaggtgac
gttctgctgctgagctgctccgggaacccggcgggggggtcacgtcaccacgccacgccc
tggatggctctcgccaaggatgccaagcacaagagcgaggcctactttgcccaagaggag
cccctgaacttttgcaagtcccccgcggctggccagaggggcccgggtctggagcacagt
gcgtgggcggtgcgggtgggccaaggcgtggccttccccccggggcggctagggaggctc
agccagtacgggaggcccggggtctacagaacgtcctccggttgccatggcaaccggaac
gactacctgtccaagccgtacggcgacggttccctgaatgccgagatggagagctactgc
gtggagggcatcaagagcgagaacgggtacctggctgccgaggagggctacagcggccgg
gtccttctggagatgcccatcaaggtggagcaggactccgactctgagaacggctgcgat
gcgtacgggttttcacacggccgctcgtggccgtgcaaagagcacgcggagaggcgctac
gccacgacctacgacggccttcagctcaagacggaggcggactactttgagcagtactca
ccctgccaaaagggcaaggttggtgcggggcccgccttcaacgggcactaccagaacgca
tgcgtgcaggaaaaccggcccctgaaatgtgtcctgaacaaagagctgacacaattctgc
cagcagcgcctgtcccactccgaccccctgtgcagcaaccagagcgcaaactgcatggaa
agtcacatgttcaccggaggggccgattccctagatcacaagggctacgcaaatcaggac
tacaagttcggctacgacttcaaggggcatggtctgctccactccatcaaacgtgagcct
atggactcaccgccctggtccgacagcggccatgaccttgaccatgtggccgtacacagg
aacatcatgtccaactgcgtcatgactgcagcgcacaaatcaaacccatatatatatatg
caataa

DBGET integrated database retrieval system