KEGG   Paramormyrops kingsleyae: 111855472
Entry
111855472         CDS       T05788                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
pki04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111855472 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111855472 (apln)
SSDB
Motif
Pfam: Apelin MSP1a
Other DBs
NCBI-GeneID: 111855472
NCBI-ProteinID: XP_023690273
Position
Unknown
AA seq 76 aa
MNVKILTLALMLLLSLLSVGGAGPMASVEQGKGVDVGNLRRLVQQSPARSAQSHRAAGWR
RRRPRPRLSHKGPMPF
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatgtgaagattctgacgctggcgctcatgctgctgctgtctctcctgtccgttggc
ggtgctggacccatggcctccgtggagcagggcaagggggtggatgtgggcaacttgagg
aggctggttcaacagagcccagccaggagtgcccaaagccacagagcggctggatggaga
agacgacgcccacgccctcgcctctcgcacaaagggcccatgccattctag

DBGET integrated database retrieval system