KEGG   Paramormyrops kingsleyae: 111856451
Entry
111856451         CDS       T05788                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki00230  Purine metabolism
pki01100  Metabolic pathways
pki04020  Calcium signaling pathway
pki04114  Oocyte meiosis
pki04261  Adrenergic signaling in cardiomyocytes
pki04270  Vascular smooth muscle contraction
pki04371  Apelin signaling pathway
pki04540  Gap junction
pki04912  GnRH signaling pathway
pki04914  Progesterone-mediated oocyte maturation
pki04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pki00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111856451
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111856451
   04020 Calcium signaling pathway
    111856451
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111856451
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111856451
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111856451
   04914 Progesterone-mediated oocyte maturation
    111856451
   04916 Melanogenesis
    111856451
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111856451
   04270 Vascular smooth muscle contraction
    111856451
Enzymes [BR:pki01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111856451
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 111856451
NCBI-ProteinID: XP_023692186
Ensembl: ENSPKIG00000011600
Position
Unknown
AA seq 1206 aa
MEVRQEDGDCFSDKEMVLPPGGDEHGEGEARPLGHSPTQTASDILASAKNKPEGTDTALE
GRGTHSRPQQDAKLSNGNATFVDPRGETLLGIATSAKVNTDMTEMTALTSNASSKSDSCD
GSIHCRPTARENSVASATDLPSPTESAGDEEGRSRRTRPSCCQPLGRFLAVLRRGLRAVY
KGCLHAIEETPTMLAGLLLTIIFCIAVIVIFAATHRNVHVHVGELAVVSVVLCVCTGLMV
VLPWLAVVRRCGGSLALFVWALLYIIAIVFIFTGGVIAAWEQVAFFLFLSLSVYTVLPLS
LTWALVFGLGTSASHIIIISVYVPVTSPKMADLAPQLVANGVLFLCVNCVGAFHRHLTER
AHRKSRRETERFGVVHSRRDLQKRQQEHLLLSVLPRYIAMELKSEIIKRLSDKYHGRDSK
QNFHSLYIQQHKDISILYADIVGFTKLASTCTPEEVVGVLNKLFGKFDDIAKKNECLRIK
ILGDCYYCVSGLPDPIPSHACNCVQMGLDMCTAINKLREATGVDIAMRVGVHSGNVLCGV
IGLQKWQYDVWSHDVTLANHMESGGLPGRVHITEDTLRHLGGAYQVEDGDGASRDPCLQG
RRTYLVIDPQTDGSTTWTSKSSRANDRRLRASVRMSQYLQSWQTINPFSELNHPVQPKAR
PTAPAFGLTEPQPTEGLAPHTVLHRENSQGTEDGVIDTLDSLDPEEEMWRKQKLNWLTLL
FNNFKTERQYRLSEVGELHLSVGCLALIFATLFVVQMLVSAKNTAIAVSYGVTFPVFVIL
LLIVFTGYLKRWRSKMPQGVQWVPSLSQGVASRAALRLLLVFLCVLITLLMAILNFFFLP
EPSCSTSQNATALEAFQLYTVPYYVYCCLLAMLGVIVFVRTCLEVKVFLLTLALVVYLAL
FLCVYAARSDCYVYQLYSNTSQPGVLKEPKIIAGVWLFIFYFTALILARKDELVCRVEFL
LQKCFQEEREEMETMENVNKLLLQNVLPAHVASVFIGKNRRNQDLYSQSCDCVCVMFASV
PQFKEFYSESSLNKDGLECLRFLNEIIADFDELLSKPKFSSVEKIKTIGSTYMAAAGLTV
TAGEEKKENNGSNSHVRSMVEFALALMAKLELNNTHSFNNFKLRIGINHGPVIAGVIGAH
KPQYDIWGNAVNVASRMDSTGVLDKIQVTEETAEVAQSLGYSVTLRGVIMVKGKGELTTY
FINTDH
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggaggtcaggcaagaagatggtgattgcttcagtgataaggagatggtacttccccct
ggaggggatgaacatggggaaggtgaggcaagacctttgggacattcccctacacagact
gccagcgacatccttgccagtgccaaaaataagcccgaaggcacagatactgctctcgaa
ggaagaggaacacactccagacctcaacaagacgccaagctcagcaatggcaatgctacg
tttgtggatcctagaggagagacacttttgggtattgccacttcagctaaagtcaacaca
gacatgacggaaatgactgctctcactagcaatgcaagtagcaagtcggactcatgtgat
ggcagcattcattgcagacctacagccagagagaatagcgtagcatccgcaacggacctt
ccatccccgacggagagcgccggagacgaggaaggcaggagtcggcgaacacgtccctcc
tgctgccagccgctagggcggttcctggcggtgttacggcgtggtctgcgggctgtgtac
aagggctgcctgcatgccatagaggagacgcccacaatgctggccggactgctactcacc
atcatcttctgcatagctgttattgtcatctttgctgccacacacaggaatgttcatgtg
catgtaggagaactggcagtggttagcgtggtcctgtgcgtgtgcactggtctgatggtg
gtgttaccttggctagcggtggtgcggcgctgtgggggatccctggccctctttgtttgg
gcgttactctacatcatcgccatcgtcttcatctttaccggtggtgtcattgccgcctgg
gagcaggttgcattcttcctcttcctctctctctccgtctatacagtactccctctctcc
ctcacctgggctcttgtgtttgggttgggcaccagtgcatctcacatcatcatcatcagc
gtctacgtgcccgtcaccagccccaaaatggccgacctggctccgcagttggtggccaat
ggcgtgctgttcctgtgtgtgaactgcgtgggtgctttccaccggcacctcacagagaga
gcccaccggaaatcccgtcgggagaccgagaggttcggtgtggtccattcaaggagggac
ttgcagaaacggcagcaggagcatctgctgttatcagttttgccacgatacattgccatg
gagcttaagtcagagattatcaagcgactgtctgataaataccatggcagagacagcaag
caaaacttccacagtctgtacatccaacagcacaaggacatcagcatcctctatgctgac
attgtgggattcaccaaactggccagcacctgcacaccagaggaggtggttggagtcctt
aacaaactgtttggtaaattcgatgacatcgcaaagaaaaacgagtgcctgcgcattaaa
attctgggggactgctattattgtgtctcaggcctgccagatcccattcctagccacgcc
tgcaactgtgtgcagatgggcctggacatgtgcaccgccatcaacaaactgagggaggcc
acaggggtggatatcgccatgcgtgtgggcgtgcactctgggaatgtgctctgcggtgtg
attggcctgcagaagtggcagtatgacgtctggtcacatgatgtgactttagccaatcac
atggagtccggcggtctaccagggagggtccatatcacggaggacacattgaggcacctg
ggtggggcctaccaggtggaggatggagatggggccagtcgagacccctgcctgcagggt
aggaggacctacctagtcattgacccacaaacagatggttccaccacatggacatctaaa
tcttccagggcgaatgacaggagactcagggcttcggtcaggatgtctcaatacctgcag
tcgtggcagacaatcaaccccttctccgagctgaaccacccagtgcagcctaaggctagg
cccactgccccagcctttggcctcacagaaccacaacccacggagggactagcccctcac
acagtcctgcacagggagaactcccagggaacggaagatggagtcattgacacactggac
tctctggaccctgaagaggagatgtggaggaaacagaagttgaactggctcactctgctg
ttcaataactttaaaacggaaagacagtaccggctgtcggaggtgggggagctgcacttg
tctgtcggctgcctggctctcatctttgctaccctctttgtggtccagatgctggtgtca
gcaaagaacactgccatagccgtgtcatatggtgtcacctttcccgtgtttgttattctc
ctcctcattgtcttcacggggtacttgaagcgatggagatccaagatgcctcagggtgtt
cagtgggttccctcgctatctcagggagtggccagcagggcggcgctacggctgctcttg
gttttcctctgtgtgctcatcacactgctcatggccattctcaactttttctttctcccg
gagcccagctgttccacatcccagaatgcaacagctctagaggccttccaactctacaca
gtgccttactacgtgtactgctgcctgttggccatgctcggcgtgatcgtgtttgtgcgg
acctgcctggaggtcaaagtcttcctgcttacgctggcgctggtggtctacctggccctg
ttcctctgcgtctatgccgctcgctctgactgctacgtgtaccagctctacagcaacacc
agccaacctggtgtcctgaaggagcctaagatcatagctggagtttggctcttcatcttt
tacttcaccgccttaattctggctcgaaaggatgagctggtgtgtcgcgtggagtttctc
ctgcagaagtgcttccaggaagagcgtgaagagatggagacaatggagaatgtcaacaag
ctgctcctacagaatgtcttgcctgctcatgtagcctccgtcttcattggcaagaatcgc
cgcaatcaggacctgtacagtcaatcctgcgattgtgtttgtgtgatgttcgcttcagta
cctcagtttaaagagttctacagcgagagttcattgaacaaggacgggctggagtgcctt
cgctttctcaatgagataattgccgacttcgatgaactcttgtccaagccaaagttcagc
agtgtggaaaaaattaaaactattggtagtacttacatggcagctgcagggctgactgtc
acagcaggagaagagaagaaggaaaacaatggctccaacagccatgtgcgctcaatggtg
gaatttgcattagctctgatggctaagctggagttaaacaacacacattctttcaacaac
ttcaaactcaggattggaataaaccatggtccagtgattgcgggggtgatcggtgcccac
aagccccaatatgacatttgggggaatgctgtcaatgtggctagcaggatggacagtact
ggagtcctggacaaaattcaggtcaccgaagaaacagcagaggtggcccagtctctgggc
tacagcgtgacactgcggggagtcatcatggtcaagggaaaaggagagctcaccacctat
ttcatcaacactgaccactga

DBGET integrated database retrieval system