KEGG   Paramormyrops kingsleyae: 111857774
Entry
111857774         CDS       T05788                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pki01002]
    111857774
Enzymes [BR:pki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111857774
Peptidases and inhibitors [BR:pki01002]
 Metallo peptidases
  Family M1
   111857774
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111857774
NCBI-ProteinID: XP_023694685
Ensembl: ENSPKIG00000012095
Position
Unknown
AA seq 954 aa
MVKISKERRTVWKMSRMYVLLSIILLPVQMTLSHSGEAESKDKATFPVAADGQPFPWHKM
RLPETIRPLHYDLRIHPNLTSLDFTGTVEIQLEVLQSTDSIILHSKNLQISKAVLLESDK
RHPLKVLELPAFEQVALVTDALSITSGRRYRVRMDFAANLSDSFHGFYKSSYRTRDGEVR
SIAATQFEPTHARAAFPCFDEPAFKANFSIRIVREAKHISLSNMPKLKTVELSGGLLEDH
FDVSVKMSTYLVAFIVSDFLSISGTSQHGVKISVYAVPDKINQTEYALNAAIKLLDFYDD
YFGIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESGLLFDPQKSSASEKLGITMVIAHEL
AHQWFGNLVTMHWWNDLWLNEGFAKFMEFVSVNITNPELQVEDYFLSKCFEAMEVDALSS
SHPVSTPVEDPTEIQEMFDDVSYDKGACILNMLRDFLTPEAFKIGIVRYLRRYSYQNTVN
AHLWESLTNFCSSDEADEERLTGGEFCSGKRGDTGASKWYMEDDLNVREMMDTWTLQEGF
PVVTVEVRGREVRLSQERYLKSKEPSQTSGFLWQIPLTYVTSTSSTVHRFLLKTKTDALY
LPEEVEWIKFNVDMSGYYIVHYESNGWDALISLLKHNHTALSSNDRASLINNIFQLVSIG
KVALDKALDLSLYLSKETEIMPVTQGLGELVPLYKLMEKRDMEDLENQMKGYIVRLFRDL
IDKQSWSDEGSVSQRMLRSYLLLFACVRGHPPCIRTATQLFSKWRESNGTLSLPSDVSLA
VYAVGARTDEGWDFLFEKYRQSLFPSVKSQIKTALSISPLPHKLQWIMGQGLAGDVLKTQ
DLPGLLVSVSKNPKGYKHAWDFLRTNWEILVKKFELGSPTVAFMVTGVTNQYSTREMLEE
VRGFFGLLQKERGAGLRCIQQTLESIEENIRWMDKNLPLLRAWLDRNISQDRGL
NT seq 2865 nt   +upstreamnt  +downstreamnt
atggtgaaaatttctaaggagaggagaacggtctggaaaatgtcgaggatgtacgtttta
ctgagcattattctcctacctgtccaaatgactctctctcattctggtgaggctgagagt
aaagataaggctacatttcctgtggcggctgatgggcagcctttcccgtggcataaaatg
aggctccctgaaacaatcagaccactgcactatgaccttcgcatccaccccaacctgacc
tcactcgactttactgggaccgttgagatccagctggaggttctgcagagcacagacagt
ataatccttcacagcaaaaacctacagatctccaaggcggtacttctggagtcagacaag
cgtcacccacttaaggttctggagttgcctgcctttgagcaggtggctcttgtgactgat
gccctcagcataacctcaggacggcgatacagagttcgcatggactttgctgctaacctc
tcagacagctttcacggcttttacaaaagctcctaccggacacgggacggagaagtgagg
tccatcgcagccacccagtttgagcccacccatgcccgtgctgccttcccctgttttgat
gaaccggccttcaaagccaatttttccattcggatcgttagagaagctaaacacatatca
ctgtccaatatgccaaagctgaagactgtagagttgtcaggaggactcctggaagaccac
tttgatgtcagcgtgaagatgagtacttacttggtggccttcattgtttcagacttcctg
tctatcagtggcacgagtcaacatggagtcaagatatcagtgtatgctgttccagacaag
atcaaccagacggaatatgctttgaatgctgcaattaagcttctggacttctatgatgat
tattttggcattccatatccacttcccaaacaagacctggctgctatccctgacttccag
tcaggagccatggagaattggggcttgaccacctaccgcgagtctgggcttctctttgac
ccacaaaagtcatctgcctcagaaaagctaggaataaccatggtcatcgcccatgaactg
gcacaccagtggtttggcaatctggtgaccatgcactggtggaatgatctttggctaaat
gagggctttgccaaattcatggagtttgtgtccgtcaacattaccaaccccgagttgcaa
gtggaggattatttcctgagtaaatgttttgaggccatggaggtagatgcactgagctcc
tctcaccctgtttccacacctgtggaggacccaactgaaattcaggagatgtttgatgac
gtttcgtacgataagggagcttgtattttaaacatgctgagagattttctcacaccagaa
gcctttaaaatcggtattgttcgatacctccgacgctacagctaccagaatacagtcaac
gcacacctgtgggaaagccttaccaatttctgctcctcggatgaagccgatgaagaaaga
ctcactggtggtgaattctgttctgggaagagaggtgacactggagcctcaaaatggtac
atggaggatgatctgaacgtgcgtgaaatgatggacacctggaccctgcaggaaggcttc
ccagtggtgactgtagaggtcagaggtcgagaggtcagattaagtcaggagagatacctt
aaaagtaaagagccctcgcagacctcagggttcctttggcagataccgctgacctatgtc
accagcacctccagcactgttcatcgattcctgctgaaaactaaaacagatgcgctctac
ctgccagaggaagttgaatggatcaagtttaacgtggacatgagtgggtattatatcgtt
cactatgaatccaatggctgggatgcgctgatctcactgctgaagcacaaccacacagca
ctcagcagcaacgacagggccagcctgatcaacaacatcttccagctagtcagtattgga
aaggtagcccttgacaaagcattggatctgagcctctacttgagtaaggagactgagatc
atgccggtgacgcagggccttggtgagctggtgcccctctacaagctcatggagaagagg
gacatggaggacctggagaaccagatgaagggctacattgtgcgtctgttccgggatctg
atcgacaagcagtcttggagcgacgagggctcagtgtcccagcggatgctgcgcagctac
ctgctgctctttgcctgcgttcgcgggcacccgccttgcatacgcactgctacgcagctg
ttcagcaagtggagggagtccaatggcaccctcagtttgcccagtgatgtcagcttggca
gtgtatgccgtgggggcacgtaccgatgagggctgggacttcctgttcgagaagtaccga
cagtctctcttcccctctgtcaaaagccagatcaagacagccctgtccatcagcccgctg
ccacataagctgcagtggattatgggacagggtctggccggggatgtcctgaagacacag
gatcttcccggccttttggtttctgtcagcaaaaacccaaaaggctacaagcatgcctgg
gatttcttgaggaccaactgggaaatactggtgaaaaagtttgaacttggctctcctacc
gttgcattcatggtgacaggtgtcaccaaccaatactccaccagggaaatgctggaagag
gtgcgaggcttctttggcctgctgcagaaagagcgcggggctgggctacgctgcatccag
cagactttggagagcattgaggagaacattcgctggatggacaagaacctgcctctgctc
agagcctggctggacaggaacatttcgcaggacagggggctgtaa

DBGET integrated database retrieval system