KEGG   Paramormyrops kingsleyae: 111858184Help
Entry
111858184         CDS       T05788                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111858184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pki04030]
    111858184
G protein-coupled receptors [BR:pki04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111858184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF621
Motif
Other DBs
NCBI-GeneID: 111858184
NCBI-ProteinID: XP_023695492
Position
Unknown
AA seq 332 aa AA seqDB search
MNGSSTWPAEQMEDIPGETVAACVILALSFIVGMPGNLMVIWTILRHVKKRSHTVVLILH
LAVADLLVLITLPLWIYSFVRSWVFGEVVCKAMVYIINSCMYSSVFFITVMSIERFIAVR
YPFTSINWKKKKLLNKLLLVLWTLAFIFSIPVIPTQVLEKVKDKEQCLFREYSSTSEEVA
FLLLETMVGFVVPFVILVVCYGCLWKRITQMTFKFKQNSMVLIISVVIVFALCWIPHHMC
NILSLMAIILESWHADMADGMESVRANMAFVTGALVFISSTVNPLLYVFAARSFRSSLRD
TGMRKLFHHISSSATDSSLYSEGLHSHQISIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatggctcaagcacatggccagctgagcaaatggaggacattccgggtgaaaccgtg
gcagcctgtgttatcctggctttgtctttcatagtgggaatgccagggaacttgatggtg
atctggacaattttgcggcacgtcaaaaagcgctcgcacactgttgttcttatccttcat
ctggctgttgctgacctgctggtgctcatcacgctgcccctgtggatctattcattcgtg
cgatcatgggtctttggcgaagtggtatgtaaagccatggtgtacatcatcaactcctgc
atgtacagcagtgtgttcttcatcacagtcatgagcatcgagcgctttattgccgtccgt
tatccattcacctccatcaactggaagaagaaaaaattgctgaataaattactgcttgtc
ctatggactctggctttcatcttcagcattcctgtaattcccacacaagttctggaaaaa
gtgaaagacaaggagcaatgtctgttcagggaatactcttcaaccagcgaagaggtggcg
tttctgcttcttgaaaccatggtgggcttcgtggttcccttcgtcatccttgtcgtctgc
tatggctgcttatggaagcgaattacgcaaatgaccttcaaatttaagcagaacagcatg
gttttaataatcagtgtcgtgattgtttttgccctgtgctggattcctcatcacatgtgt
aacattctatctctgatggctatcatactggagagctggcatgctgacatggcagatggc
atggaatctgtaagggccaacatggcctttgtcactggggcgttggtcttcatcagcagc
acggtgaaccccctgctgtatgtgtttgccgcacgctcgtttcgaagctcgctcagggac
actggcatgcgaaagctcttccatcacatctccagctcagccacagacagttcgctgtac
tcagaaggcctccacagtcaccagatctcaatcaaatag

DBGET integrated database retrieval system