KEGG   Paramormyrops kingsleyae: 111858338Help
Entry
111858338         CDS       T05788                                 

Gene name
bmpr2
Definition
(RefSeq) bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
pki  Paramormyrops kingsleyae
Pathway
pki04060  Cytokine-cytokine receptor interaction
pki04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pki00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111858338 (bmpr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111858338 (bmpr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pki01001]
    111858338 (bmpr2)
Enzymes [BR:pki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111858338 (bmpr2)
Protein kinases [BR:pki01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111858338 (bmpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 111858338
NCBI-ProteinID: XP_023695777
Ensembl: ENSPKIG00000008953
Position
Unknown
AA seq 1185 aa AA seqDB search
MREGRAKRAADKQKDLSNTAVCWGFTRIRGLQRFSAEADRLALPCAYMGLVSPPGARLDV
TASVNDLGSPCLSEGRLGKARTSRGSRTSPRSRSAAMATAVLALGICAVLLLSPVAAAQS
EERECAYYDPQQQLDEQHVDGVGHVLRENTTVRCAKGSHCYGLWGKARDGDIRLVKQGCW
THIGDQRECHNHRCVVTATPPAMQNGTYRFCCCSGNMCNVNFTENFPLPSPTSAQPLYPK
PLYREEAIVIALACVSVVAVLIVALFFGYRMLTGDRKQGLHNMDEMEAAASEPSLDLDSL
KLLELIGRGRYGSVYKGSLDEHPVAVKVFTYANRQNFVNERTIYRLPLMEQDNIARFIVA
DERLTTDGRMEYLLVMEYYPHGSLCRYLSLQTGDWVSCCRVAHSVTRGLAYLHTELLRTD
LYKPAVSHRDLNSRNVLVKSDGTCVISDFGLSMKLTGNRLVRPGEEENAAISEVGTIRYM
APEVLEGAVNLRDCESALKQVDMYALGLIYWETFMRCTDLFPGEAVPEYQMAFQAEAGNH
PSFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETMEDCWDQDAEARLTAQCAEERMAE
LLLIWDRNKSVSPTVNPAVNPAVNPTSTALQNERNLSHSRRAPKMGPYPEYSSSSYIEDH
EGGVVKTLPGEGSTVGSGSVGGSAGLPGGGEKNRNSINYERQQAQARLPSPETSGTSLSN
ATGSSTTAMGLTPSTVMTTISESGYPEEGSAAMTGTTVVPVCLQLTEEDLKTTKLDPKEV
DKNLKESSDENLMEHSLKQFCAPDPLSSGSSSLLYPLIKLAAEVTGGAGSGAMGQAEFGM
GVGEAQPPVFPLPKQQNLPKRPSSLPLGSKTPSKEPSSLRLKFGKHSKSNLKQVETGVAK
MNAVTAGEPHLATVAINGPASRVGGMADGYTGPASSPVGGSYGNASLAGPKMDGQVPLLQ
TQLSGEDGRLNSSPDEHEPLLRREQPAAREQRILDRLADHHHLAGRTNSNNNNSNNNTHN
GDGNGNRTVAAACPPAELPAVPQVSAPAAPGPPEQAPLRPERPRRAERPNSLDLSASPLE
CYSLTGDGVPQDGRAGSGEKIKRRVKTPYSLKSWRPSSWAVSSSTLDGEVNTNGGSVQCD
HIQQQNRSRPGTGRSKSSTAVFLVGGGTATSTAALASDPTSMTCL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggggagggcgaagagagctgccgataaacagaaggatttgagtaatactgca
gtttgctggggattcacacggatacgcggattacagcgtttctccgcggaggccgatcgc
ctagctctgccatgcgcttacatggggctcgtttctccgcccggagctcggctggacgtt
acggcgtcagtgaatgatctcggatcgccctgcttgagcgaggggcgactggggaaagcg
agaacttcacggggaagccgcacgtcgccgcggagccggagcgcggccatggccacggcg
gtgctggcgctggggatctgcgccgtcctgctgctcagccccgtcgcggccgctcagagc
gaagagcgcgagtgtgcctactacgacccgcagcagcagctggacgagcagcatgtggac
ggcgtgggccacgtcttgcgggagaacaccacggtgcgctgtgccaagggcagccactgc
tacggcctctgggggaaggcccgcgatggagacattcgattggtcaagcaaggctgctgg
acccacatcggcgaccagcgggaatgccacaaccaccgctgtgtggtgacagccacgccc
cccgccatgcagaacggcacctaccgcttctgctgctgcagtggaaacatgtgcaacgtc
aacttcacggagaacttccccctgcccagcccgaccagcgcccagccgctctaccctaag
ccgctgtaccgggaggaggccatcgtcatcgccctggcgtgcgtctccgtcgtggcggtc
ctcatcgtggcgctcttcttcgggtatcgcatgctgacaggagaccggaaacagggtctg
cacaacatggatgagatggaggcagccgcatcagagccctcgttggacctggacagcctg
aagcttcttgagctgattggccgaggccggtatggctcggtctacaagggctctctggac
gagcaccccgtggcagtcaaagtgtttacctacgccaatcggcagaactttgtcaatgag
cgcaccatataccggctccccctgatggagcaagacaatattgcacgcttcattgtggct
gacgagcggctgaccacggatgggcggatggagtacctgctggtgatggagtattatccc
catggctctctgtgccgatacctgagtctgcagacaggggactgggtgagctgctgccgc
gtggcccactcagtgacgcggggtctggcctacctgcacacggagctgctgcgcacagac
ctgtacaagccggcggtgtcccaccgtgacctcaacagcaggaacgtcctggtgaagagc
gacggcacatgcgtcatcagcgacttcggcctgtccatgaagctgacggggaaccggctg
gtgcgtcccggcgaggaggagaacgccgccatcagcgaggtgggcaccatccgctacatg
gcccccgaggtcctggagggagcggtgaacctgcgcgactgcgagtcagcccttaagcag
gtggacatgtacgccctcggccttatttactgggagaccttcatgcgctgcaccgacctc
ttccccggtgaggcggtcccggagtaccagatggcctttcaggccgaggcaggaaaccac
ccgtcctttgaggacatgcaggtgctggtgtcccgcgagaagcagcggccgaagttccct
gaggcctggaaggagaacagcctggcggtgcgctccctgaaggagacgatggaggactgc
tgggaccaggacgcggaggcgcgtctcacggcccagtgcgccgaggagcgcatggcggag
ctgctgctcatctgggaccggaacaagtccgtcagccccaccgtgaaccccgcggtcaat
ccggcagtgaaccccaccagcacggcgctgcagaatgagaggaacttgtctcacagccgg
cgggcacccaagatggggccctaccccgaatactcatcctcctcctacatcgaggaccac
gagggcggcgtggtgaagaccctcccaggcgaggggtccactgtgggcagcggctccgtc
ggtggctcggccggcctgccgggtggcggcgagaagaaccgcaactccatcaattacgag
cggcagcaggcacaggcccggctgcccagccccgagaccagcggtaccagcctgtccaac
gcgacgggcagcagcaccacagcgatggggctcacacccagtaccgtcatgacgaccatc
tcggaatcggggtaccctgaagaggggtcagccgcgatgacagggacgactgtggtccct
gtgtgcctgcagcttacagaggaagacctgaagaccaccaagctggacccaaaggaggtg
gacaagaacctgaaggagagttcggatgagaacctgatggagcactcgctgaagcagttc
tgtgcccccgacccgctcagctcggggagttccagcctcctgtaccctctcatcaagctg
gctgccgaggtcaccgggggtgcggggtcgggggccatgggacaggcggagtttgggatg
ggagtgggtgaagctcagccccccgtgttccccctgcccaagcagcagaacctccccaag
aggcccagcagcctgcctctgggctccaaaacccccagcaaggagccgtcctcactgcgg
ctgaagttcggcaagcacagcaagtccaacctgaagcaggtggaaacgggagtggccaag
atgaacgccgtcactgccggagagccccacctggcaaccgtcgccatcaacgggccggct
tcccgcgtgggcggcatggccgacgggtacacaggcccggcctcatcgcctgtcggtggc
tcctacgggaacgccagcctggctgggcccaagatggacggccaggtgccgctgctgcag
acccagctgagcggagaagatggccgcctgaactctagcccggacgagcacgagcccctg
ctccggagggagcagccagccgctcgggagcaacgcatcctggaccggcttgcggaccac
caccatctggcgggccgcaccaactccaacaacaacaacagcaacaacaacacccacaac
ggtgacggaaacggcaacaggaccgtcgctgcggcctgtccccccgccgagctgcccgcg
gtaccgcaggtttccgcccccgcagccccagggcccccggagcaggccccgttacgcccg
gagcggcccaggagagccgagcggcccaactccctagacctgtctgcctcccccctcgag
tgctactccctgacaggcgacggggtgccacaggacgggagagctggatcaggagagaag
attaagagacgcgtgaagacaccttactcgctgaaaagctggcggccgtccagctgggcg
gtctccagcagcaccctggacggggaggtcaacaccaacggtggaagcgtgcagtgcgac
cacatccagcagcagaataggagccggcccggcactggccggtctaaatcgagcaccgct
gttttccttgtaggtgggggcactgccacctccactgcggccctggcctccgacccaacc
agcatgacctgcctgtga

DBGET integrated database retrieval system