KEGG   Paramormyrops kingsleyae: 111858527Help
Entry
111858527         CDS       T05788                                 

Gene name
nit1
Definition
(RefSeq) deaminated glutathione amidase isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111858527 (nit1)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     111858527 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 111858527
NCBI-ProteinID: XP_023696146
Ensembl: ENSPKIG00000016558
Position
Unknown
AA seq 320 aa AA seqDB search
MLLFKTILQPRALYLRYQSSWGFCLIRKCRMSSVPLAAICQVTCTPDKEANFAACMRLVE
QAKEGGASMVFLPEGFDYIGSNQEETLKLSESLLGNTISRYTQLARKLGIWLSLGGFHER
GEDWETDRRIYNSHIIINDTGSIVSVYRKGHLFDVELTGKGVSLKESSFTIPGHSLMPPV
QTPVGKVGLGVCYDLRFPELSLALLRHGAEILTYPSAFTVATGAAHWEWTPGERCWVTVE
QLNRVWLWWRSTCRSSETPGGTCLFSSIGEMQCSTAVWTEQKAPWNISGLCALFCESQST
PHMVMVSDCPRKLFIPVLCL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgctactgttcaaaaccattttgcagccccgtgcgttgtatttgcgttatcagtcaagc
tggggtttttgcttaataagaaagtgcaggatgtcctctgtcccattggctgcaatttgt
caggtgacctgtacacctgataaggaagccaactttgctgcttgcatgcgattggtggag
caggcaaaggaaggcggggctagcatggtctttctcccagagggatttgattacatcgga
tccaaccaagaagagaccctaaagctgtcagagagtctgctggggaacaccatctcacgc
tacacccagctggccaggaaactgggtatttggctttctctggggggctttcatgagaga
ggggaagactgggagacagacaggcggatctacaatagtcacatcatcattaatgacacg
ggtagcattgtgtcagtgtacagaaagggccacctgtttgatgtggagctgacaggaaaa
ggtgtttctctgaaggagagttcctttactatacctggacacagtctgatgccccctgtt
caaaccccagtgggaaaggttggtctgggtgtatgctatgatctccgatttccagaactc
tctctggctctcctgcgtcacggagcagagattttgacctatccatcagcctttactgtg
gcaacaggtgctgcccattgggagtggacccctggggagaggtgctgggtgactgtggag
caactgaaccgggtttggctctggtggagatcgacctgcagaagctcagagacaccagga
ggaacatgcctgttcagcagcatcggcgagatgcaatgttctactgcagtctggactgag
cagaaagcgccatggaatatcagcggactctgcgcattattttgtgaatcacaaagcacc
ccacatatggttatggtgtcagactgccccagaaagttgtttattccagtcttgtgtttg
tag

DBGET integrated database retrieval system