KEGG   Paramormyrops kingsleyae: 111858732
Entry
111858732         CDS       T05788                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pki  Paramormyrops kingsleyae
Brite
KEGG Orthology (KO) [BR:pki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pki01002]
    111858732 (adamts13)
Enzymes [BR:pki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     111858732 (adamts13)
Peptidases and inhibitors [BR:pki01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   111858732 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN Reprolysin_5 Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_2 ADAM_spacer1 Peptidase_M10 Peptidase_M66 DUF2733
Other DBs
NCBI-GeneID: 111858732
NCBI-ProteinID: XP_023696514
Ensembl: ENSPKIG00000024467
Position
Unknown
AA seq 1378 aa
MAVVVFICVLSLLPGFAVSGRYPAEESLELQSFGLTSLASGMVRLGRSSPTLSEVTHLEL
LVVVGADVQQVHRQDTERYILTNLNIASELLRDTSLGANLRIHLVRTIILTEPEPDIQIT
GNITSSLISVCEWGRRVNPVSDTDPLHADLLLYITRFDLQLPDRNKQVRGVAQLGGACTS
QWSCVITEDTGFDLGITIAHEIGHSFGINHDGTGNSCGSGGFIMAADGGYGSTDLTWSQC
SREQLSRFFSAGHADCVRDLPVFGGSLQDWKPGLYYGVDDQCRIAFGSVARACSFRSGDV
DACRVLSCHTVPGDQSSCTRLLVPLLDGTECAPNQWCMKGRCVSPSQLSASMVVHGSWSG
WTEFSPCSRTCGGGVSARRRHCNNPRPAFGGNNCEGTDTEARLCNTQPCRGSQLDFMKEQ
CSMTDSQPLRLSPTSASLYHWVPAVGHVTGDLQCRLLCRSQGEDFMVSRGPQFLDGTRCE
PNSPPPPGSVPACLGGKCQLFGCDGVLHSTKVEDACGVCGGNGSSCILISASYTEGRAKE
YITFLTLPQNATRVQIVNTRPLFTHLAVLVRGKYVVAGGGRVSLNATHPSPLEDDQLTYR
LYLTPDLLPDKEEVLLHGPVTEETCVQVYRKYGKEYGEATSPSISYSFFLPRNSSSIRAK
WQTHPTSCSVTCGSGLQQSTVVCQDINTGDTLADSLCGGDPRPPGLRTPCHLLPCPPEWE
TGAFGPCSASCGTGEMVRPVRCVQMKGEERVERPASECPQNWVPLAISTCNTVPCPVRWR
VSEPGECSAVCGPGEAWRAVTCVRTERDVDSHVDDTLCLQSERPPSTVPCVVNICPVGWE
TEAEVQGKYKMVLAMAPPPRAEPVYVWSPMIGQCSKSCGMGQQHIWYTCVDHSSTQQVLE
VYCNGSSKPEPYTELCNLTACPPTWRYQQGACSATCGGGLAHQVSYCSRDTELGGEEIVS
DSECAEPRPSERVLCNPEPCPARWRVQEVGSCSASCGLGVSRRRVSCVRFEQGAERELTE
DHCPPNHRPAATQPCLVLVCTFRWEVQDWSQCSVTCGNGVQSRAVSCVGPGQPQHLSPLL
CMHLPKPITIQACHPHHCVTPAPDPPKATAQPSTPESLPTGLAHPTPGDQVTGVVSSSTP
EVTAQLTTPPPAPTVPTQTSPCGQLLLQESGQVNLSGGTSRDCILTIGRPLDEVVRVTVE
FSSLDCPSREFVAFYDRLMLVKKCERVSGFTITSHTNVLLVRQGLVTAGNGVLLTYRSLK
SSKKGLYRDCDQQLFGPAGKIVNPTRLAAPSGQACRVFINTQPSTRIEIRALSIEPALEG
IATQSTFILIRDVRAMKTTVFLGNQLFLWRSAGSAVEIEFHGGFLQHSGSFQGEYSAI
NT seq 4137 nt   +upstreamnt  +downstreamnt
atggcagtcgttgtatttatctgtgtcctgtcgcttttgccgggttttgcggtgtccggg
agatatccagccgaggagtccctggagctgcaaagttttggtctgacatcccttgcctca
ggtatggtgcggcttggacggagctcccccaccctgtctgaagtcactcacctggagctt
ctagtggtggtgggggctgatgtgcagcaggtacacaggcaggacacggagcgctatatc
ctcaccaacctgaacatagcgtcggagttgctccgggacacctctctgggggccaacctg
cggattcacctggtgcgcaccatcatcctgacagagccagagccggatatccagatcacg
ggcaacatcacttcctccctgatcagcgtgtgtgagtgggggcgcagggtgaatcccgtc
agcgacaccgatcccctgcatgctgacctgcttctctatatcacacggtttgacctgcag
ctgcctgacagaaataagcaggtgaggggtgtggctcagctgggcggggcctgtaccagc
caatggagctgcgtcatcaccgaggacacagggtttgacctgggcatcaccatcgctcat
gagataggtcacagttttggcatcaaccacgacgggacgggcaacagctgtggcagtggc
ggattcatcatggctgccgacggcggatacggcagcacagacctcacatggtctcagtgc
agccgcgagcaactgagccgcttcttcagtgcaggtcacgcagactgtgtgagggacctg
cctgtgtttgggggctccctgcaggactggaagccagggctgtactacggcgtagacgac
cagtgccggatcgcatttggcagtgtcgcccgggcctgctccttcaggagtggtgatgtc
gatgcatgccgagttctctcctgccacaccgtccctggcgatcagagctcctgcacccgc
ctgctcgtccctctgctggacggaaccgagtgcgcgcccaatcagtggtgcatgaaaggg
cgctgtgtgtccccatctcagctgagcgccagcatggtggtacacggatcctggtccggc
tggaccgagttctccccctgctcccgcacctgcggagggggagtgagcgccaggaggagg
cactgtaacaacccccggcctgcgtttggcgggaacaactgcgagggcacggacaccgag
gccagactttgtaacacacagccctgcagggggagccagctggatttcatgaaggagcag
tgctcgatgaccgactcccagccgctccgcctgtcccccaccagcgcctccctctaccac
tgggtccccgccgtgggccatgtcacaggagacctccaatgcaggctgctgtgtcgctct
cagggagaggacttcatggtgagccgtgggccgcagtttttggacgggacacgctgcgag
cccaactccccaccccctcccggctccgtccccgcttgcctgggggggaagtgccagctc
tttggctgcgatggtgtgcttcactccacgaaggtggaggacgcctgtggagtgtgcggc
ggaaacggctcgtcctgcatactcatctctgcctcctacacggagggccgcgctaaagag
tacatcacattcctgacccttccacagaatgccactcgggttcagattgttaacacacgc
cccctcttcacacatctagctgtactggtccggggaaagtatgtggtggccggggggggg
cgcgtgtccctaaacgccacacatccatcccctctggaggacgatcagctgacctatcgc
ctgtacctgacccctgacctcctgcctgacaaagaggaggtgctgctgcacgggccagta
acggaggagacgtgcgtgcaggtctacaggaagtatgggaaagagtatggggaagccacc
agccccagcatctcctactcctttttcctgcctaggaactcgagctcaatcagggccaag
tggcagacgcaccccacttcctgttctgtcacgtgcggctcagggctccagcagagcact
gttgtgtgtcaggatataaacacgggagataccttggctgactccctctgtgggggggac
cctcgcccccctggcctgcggactccctgccacctcctgccctgccctcccgagtgggag
acaggggcattcgggccctgcagcgcctcctgtggcacgggggagatggtgcggccagtc
agatgtgtccagatgaagggggaggagagggttgaacggccagcctctgaatgcccccag
aattgggtaccgctggccatcagcacctgcaacactgttccctgtcctgtaaggtggcgt
gtctccgagcctggggagtgttcggcggtgtgcggcccgggtgaggcctggcgcgcggtg
acctgtgtgcgcacagagcgtgatgtcgactcccatgtggacgacactctctgcctgcag
tccgaaaggccgcccagcacggtgccctgcgtcgtgaacatctgccccgtcggctgggag
acagaggccgaggtacaggggaaatacaagatggtacttgccatggccccgcccccacgg
gcggagccagtgtatgtgtggagccccatgattggccagtgctcaaagagctgtggaatg
ggacagcagcacatatggtacacgtgtgtggaccacagctccacacagcaggttctggag
gtctactgcaacgggtcgagcaaaccagagccgtacacagaactctgcaacctcaccgcc
tgccctccaacgtggcgctaccagcagggtgcatgcagcgcgacgtgcggagggggcctg
gctcaccaggtgtcgtactgctcccgtgatacagagttggggggggaggagattgtgagt
gactctgagtgcgccgagccccgcccatccgaaagggtcctgtgtaacccagagccctgt
cctgccagatggcgagtgcaggaggtggggtcctgctcggcgtcctgcggcctgggggtc
tcccgccggcgtgtctcctgtgtccgcttcgagcagggagctgagagggagctgactgag
gaccactgtcccccgaaccacaggccggccgccacacagccctgcctggtgctggtctgc
acattcaggtgggaggtgcaggactggagtcagtgctctgtgacctgtgggaatggggtg
cagtccagggcggtgtcctgcgtgggaccgggccagccccagcatctgagcccgctgctc
tgcatgcatctgcccaaaccaataaccatccaggcgtgccacccccaccactgtgtcacc
ccggctccagatccccccaaggccacagcgcagccctccaccccagaaagcctccccaca
ggcctggctcaccccacccctggcgatcaggtcacgggcgtggtgtcgtccagcactcca
gaggtcaccgctcagctgacgacccccccgccagctcctacagtccccacccagaccagt
ccgtgtgggcagctcctcctgcaggagtcgggccaggtgaacctgagcgggggtaccagc
cgtgactgtatcctgaccatcgggcggccgctggacgaggtggtccgcgtcaccgtggag
ttcagctccctggactgccccagcagggagtttgtggcgttctacgacaggctgatgctg
gtgaaaaagtgcgagcgagtctccggctttacgatcaccagtcacaccaatgtcctgctg
gtgcggcaggggctggtcacggccggcaatggggtcctgctcacctaccgcagcctgaag
tcctccaagaaaggcctctacagagactgtgaccagcagctgttcgggccggcgggcaag
atcgtgaaccctacgagactggcagcaccgagcgggcaggcctgccgcgtcttcatcaac
acccagccatccactcggattgagatccgggccctgagtatagaaccagcgctggagggc
attgcgacccagtccaccttcatactgatccgggacgtcagggcgatgaagaccaccgtt
ttccttggcaaccagctgttcctgtggcgctctgctggcagtgctgtggaaattgagttc
cacggaggcttcctgcagcattctgggagcttccagggggaatattctgccatctga

DBGET integrated database retrieval system