KEGG   Plasmodium knowlesi: PKH_050970Help
Entry
PKH_050970        CDS       T01094                                 

Definition
(RefSeq) ATP-dependent RNA helicase prh1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pkn  Plasmodium knowlesi
Pathway
pkn03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pkn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PKH_050970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pkn03041]
    PKH_050970
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PKH_050970
Spliceosome [BR:pkn03041]
 Complex C
  Other components
   Step II factors
    PKH_050970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD ResIII AAA_11 AAA_22 AAA_14 Flavi_DEAD T2SSE AAA_19 ABC_tran NACHT
Motif
Other DBs
NCBI-GeneID: 7319498
NCBI-ProteinID: XP_002258110
UniProt: A0A384KWG1
Position
5:join(446235..447413,447762..448055,448181..449158)
Genome map
AA seq 816 aa AA seqDB search
MIDLPILKHKKEIKKCIKRNRLIIIKGETGCGKTTQVPQIINRYFFDKRRRRGSSDAGKD
GAVCKDDNQARSPKEKAPMRMLVSLPRRVATITVAERVAKEMDRGHIGTYVGYAIRFKNV
TSDDTRIKFVTDGILIREIMNDPLLKKYTFLILDEVHERSIRTDVLLGYVRTLMEKRKKL
RIILMSATLDVDTFKNFFSDPPIISIPHKLHPVSIFYPMKPVEDYLISVVCTVLQIHFGQ
GERHDGRHDVLKDDQSDDQPDDQPEERLTELTANTRTDPPPIGDVLVFLPGQEEIEAVNL
MLKEKLKIIYKGSLLRKLIENRQGEEEEGEVLERINVALHAKNPIEDGICFHLGHREVVP
DKIYAMKILQLYSSLPNRKQRIVFEPAPPNTRKVILSTNIAETSVTIPNIKYVVDSGRVK
IKFFDAKKGSSVLKVTQISKDAAIQRSGRAGREGPGQVYRVYSKEEYDSMNPFLIPEIFR
SDLTQIYLELKAMNIANPLKFNFPENPKKELLLHSAKVLFRINAIDVENNLTDLGKKMCL
LPLNPIYANMMLCSVDFHCMDEVATIVAFLNCESIFLNYNFYEDFKIMNEESAGGSLACS
AREKRDNQDKGDVLDKDDATINAKTDESFEPAVEEDPTISDRNKLINIARRKLMHPDGDH
LTLLHIFYLWQEEATPNERKDFCNIYALNNETLQQVQKIKEQILQIMTTRMGMKISPKLH
MHKWDQVLICLCKSCFFNVARSTSNTNEFINVVTKSKLYVHPSSTLFSSHIKASFIFYSD
IVQTKRLYARTVTKVDGDWLLKYAPQNFQLVQDSTG
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgcccatattgaagcacaagaaggaaattaaaaaatgcatcaagaggaat
aggctaattattattaagggagagacggggtgcggaaagacaacccaggtaccccaaata
ataaacagatacttttttgataaaaggaggagaagaggtagtagtgacgccggtaaggat
ggagcagtctgcaaggatgataaccaagctcggtcaccgaaggagaaagctccaatgcgc
atgctggtatcgctgcccaggagagtagcaaccattactgtagctgagagagtggccaag
gaaatggatagagggcatataggaacttacgtagggtatgccatcaggtttaaaaatgta
acttccgatgacactagaattaaatttgtaacggatggaatcctgatcagggaaattatg
aatgacccattgttaaaaaaatacactttcttaatattagatgaagtgcatgaacggtcc
attaggacagatgtcctcttgggttacgttaggacattaatggagaagagaaagaagctg
aggatcatccttatgtctgcaacattagatgtggatacttttaaaaacttcttttccgac
ccacctattatttccattccgcataaactgcatcccgttagcattttctaccccatgaag
cctgtggaggattatctcatttccgttgtgtgcaccgttctgcaaatacattttggacag
ggcgagcggcacgatggcaggcatgatgtgctgaaggatgaccagtcggatgaccaaccg
gatgaccaaccggaggagcgcttgaccgagttgacagccaacacgcggaccgacccaccc
cccattggagatgtgcttgtcttcttgcccggtcaggaagaaatagaagcagtaaactta
atgctgaaagaaaagctcaaaataatttacaaaggatccctactgcgcaaactcattgag
aatcgtcagggggaggaggaagaaggggaggtgttggaaagaattaatgtcgccctccat
gcgaagaatccaatagaagatggaatttgtttccacctcggccacagggaggtggttccg
gacaagatatacgccatgaaaattctacagctctactcgtcccttccaaatagaaagcaa
cgaatagtcttcgagcccgcgccgccaaatacgagaaaggtcatcctcagcaccaatatc
gcggagacatcagttaccattccaaacataaaatacgtggtagacagcgggcgcgtcaag
ataaaattcttcgacgcgaaaaagggtagcagtgtactcaaagtcacgcaaatatcgaag
gacgccgcaatacagagaagtgggagagcagggcgagagggacccggacaagtctacagg
gtgtactccaaggaggagtacgacagcatgaacccgtttttaattcccgagatttttcgc
tctgatctgacacagatatatttggagttgaaggccatgaatattgctaacccactgaag
tttaacttccccgaaaatccaaagaaggagctactgctgcactccgccaaagtcctcttc
cgaatcaacgcaattgacgtggaaaacaacctgaccgatcttgggaaaaagatgtgcctc
cttccactgaacccaatatatgcaaacatgatgttgtgttctgtggatttccattgtatg
gatgaagtcgctaccatcgtggcgttcctaaactgcgagagcatattcttgaactataat
ttttatgaggacttcaaaattatgaatgaggaatcggcaggaggttcccttgcatgttcc
gccagagaaaaacgcgacaaccaggacaaaggcgatgtactggacaaggacgacgccacc
attaatgcaaagacggatgaatcttttgaacccgccgtcgaggaggacccaactataagc
gacagaaacaaattaattaacatcgcgcgcaggaagctcatgcacccggatggagatcac
ctaaccctcttgcacatcttctatctctggcaggaagaagccactcccaacgagcgaaag
gatttttgcaacatatatgccttgaacaacgaaaccttacaacaagtacagaaaataaag
gagcaaattctgcaaataatgactacaagaatgggcatgaaaatatcaccaaagctacat
atgcataaatgggatcaagtattaatttgtctctgcaaatcctgtttttttaatgtggct
agatctacatctaatacaaatgagtttataaatgtcgtaacaaagagcaagttgtatgtc
cacccatcgtctactcttttcagttcgcacatcaaggcatccttcattttttattcggac
attgtgcaaacaaagcgcctctacgcacgaaccgttacaaaggtagacggagattggctt
ctcaaatatgctcctcaaaacttccaactcgtgcaggactccacggggtag

DBGET integrated database retrieval system