KEGG   Plasmodium knowlesi: PKH_060990Help
Entry
PKH_060990        CDS       T01094                                 

Definition
(RefSeq) Copper chaperone
  KO
K02260  cytochrome c oxidase assembly protein subunit 17
Organism
pkn  Plasmodium knowlesi
Pathway
pkn00190  Oxidative phosphorylation
pkn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkn00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PKH_060990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pkn03029]
    PKH_060990
Mitochondrial biogenesis [BR:pkn03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    PKH_060990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX17
Motif
Other DBs
NCBI-GeneID: 7319783
NCBI-ProteinID: XP_002261774
UniProt: A0A384KV75
Position
6:477541..477744
Genome map
AA seq 67 aa AA seqDB search
MGFFSNWPFKNTSEEAKGGAPKKKICCVCLETKKLRDECIVKLGEEQCRKYIEDHNQCLR
NEGFDVK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcttctctaactggccgttcaaaaacaccagtgaagaggccaagggaggggcg
ccgaagaagaagatctgttgcgtctgcctggaaaccaagaaactacgagacgagtgcatc
gtcaaacttggagaggagcagtgcaggaaatatattgaagaccacaaccagtgtttgcgg
aatgagggcttcgacgtgaagtaa

DBGET integrated database retrieval system