KEGG   Plasmodium knowlesi: PKH_090230Help
Entry
PKH_090230        CDS       T01094                                 

Definition
(RefSeq) histone h2b
  KO
K11252  histone H2B
Organism
pkn  Plasmodium knowlesi
Brite
Chromosome and associated proteins [BR:pkn03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PKH_090230
Exosome [BR:pkn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PKH_090230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa TAF CNDH2_C
Motif
Other DBs
NCBI-GeneID: 7320768
NCBI-ProteinID: XP_002259051
UniProt: A0A1A7VD81 B3L4K3
Position
9:107410..107763
Genome map
AA seq 117 aa AA seqDB search
MVSKKPAKAKKAATGPDGKKKRKKSKYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLV
DTFEKIATEASRLCKYTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtatccaaaaagccagcgaaagcgaaaaaggccgccactggtcctgacggaaagaag
aagagaaaaaagtcaaaatatgacagctatggactttacatttttaaagttttgaaacaa
gttcacccagacactggtatttcgaggaaatccatgaacatcatgaactccttccttgtt
gatacttttgagaaaattgcaactgaagcctccagattgtgtaaatacaccaaaagggac
accttgtcatcacgtgaaattcaaactgccatcagattggtattgccaggagaattggcc
aagcacgcagtttcggaaggaaccaaggccgttacgaaatttacctccaagtaa

DBGET integrated database retrieval system