KEGG   Plasmodium knowlesi: PKH_125960Help
Entry
PKH_125960        CDS       T01094                                 

Definition
(RefSeq) Fasciclin domain containing protein, conserved
  KO
K17949  heme ligase [EC:4.99.1.8]
Organism
pkn  Plasmodium knowlesi
Brite
KEGG Orthology (KO) [BR:pkn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PKH_125960
Enzymes [BR:pkn01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.8  heme ligase
     PKH_125960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fasciclin
Motif
Other DBs
NCBI-GeneID: 7321940
NCBI-ProteinID: XP_002260406
UniProt: A0A384L7P6 A0A5K1VAB3
Position
12:complement(join(2562949..2563149,2563301..2563503,2563696..2563954))
Genome map
AA seq 220 aa AA seqDB search
MRTHLPKIRPKYKRMKKSHPPFLIIKRLYTRSGGLRKPQKVTNDPESINRKTYWCFEHKP
IKRTMVNLIYSHNELKLFSRFLSHPNVGTSLIHELSLEGPYTGFLPSNEALKLISPESLA
KLYEQGDKLMEFVLGHFTKDFWLYRDLYGSSYQPWLVFNEKREAPEKITNLVNKDLLVKI
TGEFKNCDHSIFLNGAKIIRPNMKCHNGVVHIVDRPIIQR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacacatctccccaaaattaggcccaagtacaaaagaatgaaaaagagccacccc
cccttccttatcattaaaaggttatacacacgcagtggaggattgaggaaaccacaaaaa
gtgacgaacgatcccgaaagcattaacagaaaaacatactggtgcttcgaacacaaacct
attaaaaggacgatggtcaatttgatatactcccacaatgaactgaaattattttcccgc
tttctgagtcatcccaatgtcggtacctccctcatacacgagctatccttggaaggcccc
tatacggggttcctgccttcgaacgaggctctgaaattaattagccccgaaagcttagcc
aaattatatgaacaaggagataaattgatggaatttgttttggggcactttacgaaggac
ttctggctctacagagatctctacggatcttcctaccagccctggctcgtatttaacgag
aaaagggaagcccctgagaaaatcaccaacttagttaacaaagacctacttgtaaaaata
acaggagagtttaaaaattgcgatcactccattttccttaatggagcgaagatcatcaga
ccaaatatgaagtgccacaacggagtggtccatattgtagacaggccgattatacagagg
tag

DBGET integrated database retrieval system