KEGG   Plasmodium knowlesi: PKH_142210Help
Entry
PKH_142210        CDS       T01094                                 

Definition
(RefSeq) 4-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pkn  Plasmodium knowlesi
Brite
Enzymes [BR:pkn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PKH_142210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 7323720
NCBI-ProteinID: XP_002262125
UniProt: A0A384LPB2
Position
14:995525..996469
Genome map
AA seq 314 aa AA seqDB search
MSLIRPEKRQSEYESFMKEWQIEKSVDAKEFVDNCQVFFFDCDGVLWRGNEVIQGAVEVI
NKLIKEKKQIYFITNNSTKSRITLLEKFHKLGFGLIKKENIICTSYAIAKYFMEKEEYTS
GKKKIYVIGEKGICEELDCSNLLWLGSYKDNEKKVVIKDDLEITVDKNIGAVVVAIDFNI
NYYKIQYAHLCINELDAEFIVSNKDATANFTCKQKWAGTGSIVASVEAVSLKKPTVLGKP
NLFMIENVLKDLNVDPAKVVMVGDRLDTDISFAKNCNIKSVLVSSGVTDANIYLNHNHSN
IVPDFFMKSIAEFL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgatacgcccggagaaacgacaaagcgaatatgaaagtttcatgaaggagtgg
caaatagaaaagtcggtggacgcaaaggaatttgtggacaattgccaagttttctttttc
gattgcgatggagttctatggagaggaaatgaagttatacaaggagcagtggaagttata
aacaaattaataaaagaaaagaagcaaatttattttataacgaataattctacaaaatcg
aggattacactgttggagaaatttcacaagttaggtttcggtcttattaaaaaagaaaat
attatttgtacttcctatgcaattgctaaatattttatggaaaaagaagaatacacgagt
ggcaaaaaaaaaatttatgttattggagaaaaaggcatttgtgaggaactcgattgttct
aatcttctttggttgggtagctacaaggataatgaaaagaaagtagtaataaaggatgat
ttagaaataactgtggataaaaacattggagctgttgtagttgccatcgactttaacatt
aattattacaaaatccagtacgcacatctttgcataaatgaattggacgctgagtttatt
gtttccaataaagacgcaactgctaactttacttgcaaacaaaaatgggctggaacgggt
tctatcgttgctagtgttgaagctgtttctctaaagaagccaacggttcttggcaagccc
aatttattcatgatagaaaatgtccttaaagatctaaatgttgaccctgccaaagttgtt
atggtaggagatagactcgacacagatataagctttgctaaaaattgcaacatcaagtct
gttctcgtttcctcaggtgttacagatgccaatatttatctaaaccataaccattcaaat
attgtccctgacttttttatgaaatcgatagcggaatttttataa

DBGET integrated database retrieval system