KEGG   Pontibacter korlensis: PKOR_11095Help
Entry
PKOR_11095        CDS       T03841                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pko  Pontibacter korlensis
Pathway
pko00540  Lipopolysaccharide biosynthesis
pko01100  Metabolic pathways
Module
pko_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pko00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PKOR_11095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pko01005]
    PKOR_11095
Enzymes [BR:pko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PKOR_11095
Lipopolysaccharide biosynthesis proteins [BR:pko01005]
 Unusual sugar
  PKOR_11095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AKD03580
UniProt: A0A0E3ZGQ1
Position
complement(2552850..2553815)
Genome map
AA seq 321 aa AA seqDB search
MIVVTGAAGFIASCLVSRLNQDNFNDIVVVDNFSVAKKEDNLKGKKIKEFVDRDNFFEWL
DEHYEDVEFIFHLGARTDTTEFNKDVFDLLNLNYSKQMWNACAEYQIPLVYASSAATYGS
GTLGYDDNEATIPLLKPLNPYGESKNDFDIWALEQTAKPFFWAGLKFFNVYGPNEYHKGK
MASVIFHAYNQIKDHGSMKLFRSHNPDYADGEQMRDFVYVKDVVDVCMFLMHHRKNSGIY
NLGSGQARTFMALALNTFEAMGIEPNIDFMDTPENLRANYQYFTEANMSKLRSIGYDKPF
YTLEEGVNDYVQNYLMEEKYY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatagtagtaacaggtgccgctggtttcatcgccagctgcctcgtaagcaggctgaac
caggacaatttcaatgatatagtggtggtggataatttttccgttgccaagaaggaagat
aacctgaaagggaagaaaataaaggagttcgtagaccgcgataacttctttgagtggctg
gatgagcactatgaggatgtcgagtttatcttccacctgggcgcccgcaccgacactacc
gagttcaacaaggacgtgttcgacctgctgaacctgaattactccaagcaaatgtggaac
gcctgtgctgaataccagattccgctggtgtacgcttcttcggctgccacttatggctca
ggcaccttgggctacgacgataatgaagccaccattccgttgctaaaaccgctcaaccct
tacggcgagtctaaaaacgattttgatatctgggcactggagcaaacagccaagcctttc
ttttgggcaggactgaaattctttaacgtatatggccctaacgagtatcataagggtaaa
atggcttccgttattttccatgcctataaccagataaaggatcatggcagcatgaagctg
ttccgctcgcacaatcctgattatgcagatggtgagcagatgcgcgattttgtctatgta
aaggatgtggtggatgtatgtatgttcctgatgcatcaccgcaagaactctggcatctat
aatcttggctccggccaggcccgtaccttcatggcgctggcgctaaataccttcgaagcc
atgggcatagagccaaatattgactttatggataccccggagaacctgcgcgccaactac
cagtacttcacggaggccaacatgagcaagttgcgctctatcgggtatgataagccattt
tatactcttgaggaaggcgtgaatgattatgtacagaattacctgatggaagagaagtat
tactaa

DBGET integrated database retrieval system