KEGG   Pontibacter korlensis: PKOR_17035Help
Entry
PKOR_17035        CDS       T03841                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
pko  Pontibacter korlensis
Brite
KEGG Orthology (KO) [BR:pko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PKOR_17035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AKD04482
UniProt: A0A0E3UXR1
Position
complement(3968980..3969366)
Genome map
AA seq 128 aa AA seqDB search
MDTKTTEGVKVSVTTNYLPDYSSPVQQHFVFAYRIKIENNSEFTVKLLRRHWYIHDATGQ
MREVEGEGVVGQQPTLEPGEMHEYVSGCNLKTGIGKMRGTYLMERLVDGRKFDVTIPEFT
LVVPYKLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaaacaacggaaggtgtaaaagtaagtgttaccaccaactacttacctgac
tattctagtccggtacagcagcactttgtttttgcctacaggataaagatagagaacaac
agtgaatttactgtgaagctgctgcgtcgccattggtacatacacgatgctacaggccaa
atgcgcgaagtggagggtgaaggagttgtaggacagcaaccaactttggaacctggcgag
atgcatgagtatgtatccggctgcaacttaaaaaccggcattggtaaaatgcgaggcacc
tacctaatggagcgtcttgtggatggtcgaaaattcgacgtaaccataccagagtttaca
ctagttgtaccttataaacttaattaa

DBGET integrated database retrieval system