KEGG   Pseudomonas koreensis: AYO71_05550Help
Entry
AYO71_05550       CDS       T04647                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00010  Glycolysis / Gluconeogenesis
pkr00053  Ascorbate and aldarate metabolism
pkr00071  Fatty acid degradation
pkr00280  Valine, leucine and isoleucine degradation
pkr00310  Lysine degradation
pkr00330  Arginine and proline metabolism
pkr00340  Histidine metabolism
pkr00380  Tryptophan metabolism
pkr00410  beta-Alanine metabolism
pkr00561  Glycerolipid metabolism
pkr00620  Pyruvate metabolism
pkr00625  Chloroalkane and chloroalkene degradation
pkr00903  Limonene and pinene degradation
pkr01100  Metabolic pathways
pkr01110  Biosynthesis of secondary metabolites
pkr01120  Microbial metabolism in diverse environments
pkr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYO71_05550
   00053 Ascorbate and aldarate metabolism
    AYO71_05550
   00620 Pyruvate metabolism
    AYO71_05550
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYO71_05550
   00561 Glycerolipid metabolism
    AYO71_05550
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYO71_05550
   00310 Lysine degradation
    AYO71_05550
   00330 Arginine and proline metabolism
    AYO71_05550
   00340 Histidine metabolism
    AYO71_05550
   00380 Tryptophan metabolism
    AYO71_05550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AYO71_05550
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AYO71_05550
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AYO71_05550
Enzymes [BR:pkr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AYO71_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMT87027
UniProt: A0A142N5N4
Position
1269002..1270492
Genome map
AA seq 496 aa AA seqDB search
MVAALLDRLGVNPALYQNGKVPVHSPIDGSEIASVNWEGAAEVEQHISRADHAFEQWRNV
PAPRRGELVRQFGEVLREYKADLGELVSWEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTIASERPGHHMRETWHPLGVVGVISAFNFPVAVWAWNTTLALVCGNPVVWKPSEKTPL
TALACQALFDRVVKNFSDAPPSLCQVVIGGRDAGEALVDDPRVALISATGSTRMGREVAP
KVAARFARSILELGGNNAMILGPSADLDMAVRAILFSAVGTAGQRCTTLRRLIAHESVKE
EIVTRLKAAYSKVRIGHPLEGNLVGPLIDRHSFENMQDALEQALSEGGRVFGGKRQLEEQ
FPNAYYVSPAIVEMPEQSDVVCSETFAPILYVVGYSDFEEALRLNNAVPQGLSSCIFTTD
VREAERFMSAVGSDCGIANVNIGPSGAEIGGAFGGEKETGGGRESGSDAWRAYMRRQTNT
VNYSLELPLAQGITFD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgcattgcttgatcgtctgggagtcaacccggccctgtaccagaacggcaag
gtgccggtgcattcgcccattgatggcagtgaaattgcctcggtgaactgggagggcgct
gccgaagtcgagcagcacatcagtcgcgcagatcatgcattcgagcaatggcgcaacgtg
ccggcaccgcgtcgcggtgagctggtgcgtcagttcggcgaagtgttgcgcgagtacaag
gccgatctcggcgagctggtgtcgtgggaggctggcaagatcactcaggaaggcctgggt
gaagtacaggagatgatcgacatctgcgatttcgccgttggcctgtcgcgccagttgtac
ggtctgaccatcgcctccgagcgcccgggccaccatatgcgtgaaacctggcatccgctc
ggcgtggtcggcgtcatcagcgcgttcaacttcccggtcgcagtgtgggcgtggaacacc
accctggcgctggtctgcggcaacccggtggtgtggaagccatcagagaaaaccccgctg
accgcgctggcttgtcaggcgctgtttgatcgcgtggtgaaaaatttcagtgatgcccca
ccgagcctgtgccaagtggtgatcggcggacgcgatgccggcgaagcgctggtcgatgat
ccgcgtgttgcgctgatcagtgccaccggcagcacgcgcatgggccgcgaagtggcgccg
aaagtcgccgcgcgtttcgcccgcagcattctcgaactgggcggcaacaacgcgatgatc
ctcggcccgagcgccgatctggacatggcagtgcgcgcgattctgttcagcgccgtcggc
accgccgggcaacgctgcacgactttgcgccgtctgattgcccatgagtcggtcaaggaa
gaaatcgtcacccgcctcaaggctgcctattcgaaagtacgcatcggccatccgctggaa
ggcaatctggtcggcccgctgatcgacaggcacagcttcgaaaacatgcaggatgcgctg
gaacaggcactgagcgaaggcggccgggtgttcggtggcaagcgccaactggaagagcaa
ttccccaatgcttattacgtgtcgccggccatcgtggaaatgcccgagcagagcgatgtg
gtctgcagcgaaaccttcgcgccgattctctacgtggtcggctacagcgatttcgaggaa
gcgctgcgcctgaacaatgccgtgccgcaaggcctgtcatcgtgcatcttcaccaccgac
gtgcgtgaggccgagcggttcatgtcggcggtcggcagtgactgcggcatcgccaacgtc
aacatcggcccgagcggcgcggaaatcggcggcgcctttggtggcgagaaagaaaccggc
ggcggccgtgagtccggctccgatgcctggcgcgcgtacatgcgccggcagaccaacacc
gtcaactactcgctggaattgccgttggcgcagggcattacattcgattaa

DBGET integrated database retrieval system