KEGG   Pseudomonas koreensis: AYO71_16620Help
Entry
AYO71_16620       CDS       T04647                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pkr  Pseudomonas koreensis
Pathway
pkr00071  Fatty acid degradation
pkr00072  Synthesis and degradation of ketone bodies
pkr00280  Valine, leucine and isoleucine degradation
pkr00310  Lysine degradation
pkr00362  Benzoate degradation
pkr00380  Tryptophan metabolism
pkr00620  Pyruvate metabolism
pkr00630  Glyoxylate and dicarboxylate metabolism
pkr00640  Propanoate metabolism
pkr00650  Butanoate metabolism
pkr00900  Terpenoid backbone biosynthesis
pkr01100  Metabolic pathways
pkr01110  Biosynthesis of secondary metabolites
pkr01120  Microbial metabolism in diverse environments
pkr01130  Biosynthesis of antibiotics
pkr01200  Carbon metabolism
pkr01212  Fatty acid metabolism
pkr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYO71_16620
   00630 Glyoxylate and dicarboxylate metabolism
    AYO71_16620
   00640 Propanoate metabolism
    AYO71_16620
   00650 Butanoate metabolism
    AYO71_16620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYO71_16620
   00072 Synthesis and degradation of ketone bodies
    AYO71_16620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYO71_16620
   00310 Lysine degradation
    AYO71_16620
   00380 Tryptophan metabolism
    AYO71_16620
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYO71_16620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYO71_16620
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYO71_16620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkr04147]
    AYO71_16620
Enzymes [BR:pkr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYO71_16620
Exosome [BR:pkr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYO71_16620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMT89083
UniProt: A0A142NAU0
Position
complement(3717394..3718596)
Genome map
AA seq 400 aa AA seqDB search
MLDAYIFAGLRTPFGRHGGALASVRPDDLAAHVIHELLARHAIPGEAIEDVILGNTNQAG
EDSRNIARHAALLAGLPVTVPGQTVNRLCASGLAAVIDAARAVTCNEGELFVAGGVESMS
RAPFVMAKAEAAYSRELTVFDSTIGARFPNPKIVAEFGNDSMPQTGDNVAQEYGISRAEA
DVFAAGSQARYEAARSAGFFQEELLAVSVPTGRKTPPNVVEQDEHPRPQSDLIALARLNP
LSEGGVVTAGNASGVNDGAAALLIGSAAAGERHGLVPMARILSAAAVGVAPRIMGVGPVE
AIHKALARAQLSLADMDIIEINEAFASQVLGCLKGLGVAFNDPRVNPHGGAIAVGHPLGA
SGARLALSTARALQQSGKRYAVVSLCIGVGQGLAMVMERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctacatcttcgcgggactgcgcacgccatttggccgccacggcggcgca
ctcgcttcggtacgcccagacgacctcgccgcccatgtgatccacgaattgctcgctcgc
cacgccatccctggcgaagccatcgaggacgtgattctgggcaataccaaccaggcaggg
gaggacagccgcaacatcgcgcgtcacgccgcactgcttgcaggcttgcccgtgaccgta
cctgggcagacagttaaccgcctgtgcgccagtggtctggcggcggtgatcgatgccgcc
cgcgcagtgacctgtaacgaaggcgaactgtttgtcgccggcggggtggagagtatgtcc
cgtgcaccctttgtcatggctaaagcagaagcggcctatagccgcgaactgacggtgttc
gacagtaccattggcgcccgttttcccaacccgaagatcgtcgccgagtttggcaacgac
agcatgccgcaaacgggcgataacgtggctcaggagtacggcatctcccgtgctgaggcc
gacgtctttgctgccggctctcaggcccgttatgaagccgcacgtagcgcaggtttcttt
caggaagaactgctcgcggtcagcgtgcccaccgggcgcaagacgccacccaatgtggtg
gagcaggacgagcacccgcgcccgcaatcggacctgatcgctttggctcgcctgaatcct
ctctccgaaggtggtgtggttaccgccggcaacgcatcaggcgtcaacgatggcgcggcg
gcattgctgattggctcggccgcggcgggcgaacggcacggcttggttccgatggcgcgc
attctgtcggccgccgccgtgggtgtggccccgcgcattatgggcgtcggcccggtggag
gctattcataaggcattggctcgcgcgcagctcagcctggcggatatggacattatcgag
atcaacgaagcgttcgccagccaggtgctgggctgcctgaaaggtctgggtgttgcgttc
aacgacccgcgggtaaacccacacggtggcgccatcgccgtcggccacccattaggtgca
tccggtgcgcgcctggccctgagcaccgctcgcgcgctgcaacagagcggcaaacgctac
gctgtggtgagcctatgcatcggcgtgggccaaggcctcgccatggtgatggagcgtgtg
taa

DBGET integrated database retrieval system