KEGG   Paucibacter sp. KCTC 42545: AT984_01000Help
Entry
AT984_01000       CDS       T04227                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00071  Fatty acid degradation
pkt00072  Synthesis and degradation of ketone bodies
pkt00280  Valine, leucine and isoleucine degradation
pkt00310  Lysine degradation
pkt00362  Benzoate degradation
pkt00380  Tryptophan metabolism
pkt00620  Pyruvate metabolism
pkt00630  Glyoxylate and dicarboxylate metabolism
pkt00640  Propanoate metabolism
pkt00650  Butanoate metabolism
pkt00900  Terpenoid backbone biosynthesis
pkt01100  Metabolic pathways
pkt01110  Biosynthesis of secondary metabolites
pkt01120  Microbial metabolism in diverse environments
pkt01130  Biosynthesis of antibiotics
pkt01200  Carbon metabolism
pkt01212  Fatty acid metabolism
pkt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT984_01000
   00630 Glyoxylate and dicarboxylate metabolism
    AT984_01000
   00640 Propanoate metabolism
    AT984_01000
   00650 Butanoate metabolism
    AT984_01000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT984_01000
   00072 Synthesis and degradation of ketone bodies
    AT984_01000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT984_01000
   00310 Lysine degradation
    AT984_01000
   00380 Tryptophan metabolism
    AT984_01000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT984_01000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT984_01000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AT984_01000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkt04147]
    AT984_01000
Enzymes [BR:pkt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AT984_01000
Exosome [BR:pkt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT984_01000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALT76001
UniProt: A0A0U3EXC6
Position
223761..224942
Genome map
AA seq 393 aa AA seqDB search
MSTDSIVIVSAARTPIGGLLGDFAGLQAWELAAVAIKAAVERSGIPGDAINEAFIGNCLM
AGQGQAPARQAVLKAGLPQSVGAVTLSKMCGAGMRATMFAHDTLKAESADVLIAGGMESM
TNAPHLMFARKGVKYGATQMFDHMALDGLEDAYQRGKAMGVFAEQCVAKYAFSREAQDAF
AVASTERAKRANEDGSFAWEMAPVTVTNRGVDTIFSKDEQPFKAKLDKIAGLKPAFVKDG
TITAATSSSISDGAAALVLMRESTAAKLGVKPVARIVGHAVHANAPEWFTTAPVGAIEKL
LKKNGWDAKSVDLWEVNEAFAAVTMAAMAEFKLPHEIVNVNGGAVALGHPIGASGARILV
TLIGALKHRGLKRGVAALCIGGGEATAMGVELI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgattccatcgtcatcgtttccgccgcccgcacgcccatcggtggcctgctg
ggtgacttcgctggcttgcaagcctgggagctggcagctgttgccatcaaggccgcggtt
gagcgctcgggcatccccggcgacgccatcaacgaagccttcatcggcaactgcctgatg
gccggccaaggccaggcccccgcccgccaagccgtgctgaaggctggcctgccccagtcg
gtcggtgccgtcacgctgagcaagatgtgcggcgccggcatgcgcgccaccatgtttgcc
cacgacacgctcaaggccgaaagcgccgacgtgctgatcgccggcggcatggagagcatg
accaatgcgccccacctgatgttcgcccgcaaaggcgtgaagtacggcgccacgcaaatg
ttcgaccacatggccctggacggcctggaagacgcttaccagcgcggcaaggccatgggc
gtgttcgctgagcaatgcgtcgccaagtacgccttcagccgcgaagcgcaagacgccttc
gccgtggcctccaccgagcgcgccaagcgcgccaacgaagacggcagcttcgcctgggaa
atggcccccgtcaccgtcacgaaccgcggcgtggacaccatcttcagcaaggacgaacag
cccttcaaggccaagctggacaagatcgccggcctcaagcccgcgttcgtgaaggacggc
accatcaccgccgccacctccagctccatctccgacggcgccgccgccctggtgctgatg
cgtgaaagcaccgccgccaagctgggcgtcaagcccgtggcccgcatcgttggccacgcc
gtgcatgccaacgcgcctgaatggttcaccaccgccccggtcggcgccattgaaaagctg
ctgaagaaaaacggctgggacgccaagagcgtggacctgtgggaagtcaacgaagccttc
gctgccgtgaccatggccgccatggccgagttcaagctcccgcatgaaatcgtcaacgtc
aacggcggtgcggttgccctgggccaccccatcggcgcctccggcgcccgcatcctggtc
accctgatcggcgccctgaagcaccgcggcctgaagcgcggcgtggccgccctgtgcatc
ggcggcggcgaggcgacagccatgggtgttgagctgatctga

DBGET integrated database retrieval system