KEGG   Paucibacter sp. KCTC 42545: AT984_04815Help
Entry
AT984_04815       CDS       T04227                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00450  Selenocompound metabolism
pkt00970  Aminoacyl-tRNA biosynthesis
pkt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AT984_04815
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT984_04815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pkt01007]
    AT984_04815
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pkt03016]
    AT984_04815
Enzymes [BR:pkt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AT984_04815
Amino acid related enzymes [BR:pkt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AT984_04815
Transfer RNA biogenesis [BR:pkt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AT984_04815
 Prokaryotic type
   Other AARSs
    AT984_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALT79639
UniProt: A0A0U3EZW9
Position
complement(1090364..1092409)
Genome map
AA seq 681 aa AA seqDB search
MTRKLFVTTALPYANANFHIGHIMEYTQADVWVRFQRMMGQEVHFVCADDAHGAPIMIAA
EKAGKTPQQFVADIASGRKPYLDGFHISFDNWHSTDGAENHELSKDVYRALRRQELIDVK
AIEQFFDPEKSMFLPDRFIKGECPKCGAKDQYGDSCEVCGAVYAPTEVKNPYSVLTGATP
ILKSSEHYFFKLSDPRCIAFLEEWTQSPGRLQPEVFNKIKEWFTKDEEGKGGLGDWDISR
DAPYFGIEIPDAPGKYFYVWLDAPIGYLASLKNYFGKIGRDFDAFLADPEVEQIHFIGKD
ITYFHTLFWPAMLHFSGRKTPDHVFVHGFMTVNNGEKMSKSRGTGLDPMKYLSLGLNAEC
LRYYIAAKLNGRVEDIDFNPEDFVARINSDLVGKYINIASRAAGFLSKRFGGHLSGDVGV
EGRTLLDGLRADAATIAELYEEREFGKALRETMLLADRVNEYVDQNKPWELAKQEGKDAV
LQDVCSVCIEAFRLLTIYLKPVLPALAAKVEAFLRVEPLQFSDAARALGAHQIGTYEHLM
QRVDIKVVEALFEAPPAPKVIPGGEDTAPEIKIDDFSKVDLRIAKIVKAEHVEGSDKLLR
LTLDAGEGRLRNVFSGIKSAYQPEQLEGKLTVMVANLAPRKMKFGISEGMVLAASHADEK
ANPGIFVLEPFPGAQPGMRVR
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaagctcttcgtcaccaccgcccttccctacgccaacgccaacttccacatt
ggccacatcatggaatacacccaggccgatgtctgggtgcgcttccagcgcatgatgggt
caggaggtgcactttgtttgcgccgacgacgcgcacggcgcgcccatcatgattgcggcc
gaaaaggccggcaaaacgccgcagcaattcgtggccgacatcgcctcgggccgcaagccc
tatctcgacggcttccacatcagctttgacaactggcactccaccgacggcgcggagaac
catgagttgtccaaagacgtctaccgcgccctgcgccgccaggaactgatcgatgtgaaa
gcgatcgagcaattcttcgaccccgagaagtcgatgttcctgccggaccgcttcatcaag
ggcgaatgccccaagtgcggcgccaaggatcagtacggcgattcctgcgaagtctgcggc
gccgtctacgcgccgaccgaagtcaagaacccctactcggtgctgaccggcgccacgccc
atcctcaagagttcggagcactacttcttcaagctcagcgatccgcgctgcatcgccttc
ctcgaagaatggacgcaatcgccgggccggctgcagcccgaggttttcaacaagatcaag
gaatggttcaccaaggacgaagagggcaagggcggcctgggcgactgggacatcagccgc
gacgcgccttacttcggcatcgagatccccgacgcgccgggcaagtatttctacgtttgg
ctggacgcaccgattggctatctggcctcgctgaagaactatttcggcaagatcggccgc
gactttgacgccttcctggccgaccccgaggtggagcagatccacttcattggcaaagac
atcacctatttccacaccttgttctggcccgccatgctgcacttcagcggccgcaagacg
cctgaccacgtgttcgtgcacggcttcatgaccgtcaacaacggcgaaaagatgagcaag
agccgcggcaccggcttggacccgatgaagtacctcagcctgggcctgaacgccgagtgc
ctgcgctactacatcgccgccaagctcaacggccgggtcgaggacatcgacttcaacccg
gaagactttgtcgcccgcatcaatagcgacctggttggcaagtacatcaacatcgcgtcg
cgcgccgccggcttcctgagtaagcgtttcggcggccatttgtccggcgatgtgggcgtc
gaaggccgcaccttgctggacggtctgcgcgccgatgccgcaacaattgccgagctgtac
gaagagcgcgaattcggcaaagccttgcgcgagaccatgctgctggccgaccgcgtcaac
gagtatgtggatcagaacaagccctgggaattggccaaacaagaaggcaaggacgccgtg
ctgcaagacgtttgcagcgtctgcatcgaagccttccgcctgctgacgatctacctcaag
ccggtgctgcccgcgctggccgccaaggtggaagcctttttgcgcgtcgagcccctgcaa
ttcagcgatgccgcccgcgcactcggcgcccatcagatcggcacctatgagcatttgatg
cagcgcgtcgacatcaaggtggtcgaggccttattcgaagcaccgcctgcgccgaaagtg
attcccggcggcgaagacaccgcgcccgagatcaagatcgatgacttcagcaaggtcgat
ctgcgcattgccaagatcgtcaaggccgagcatgtggaaggctccgacaaattgctgcgc
ctgaccctggacgccggcgaaggccgcctgcgcaatgtgttcagcggaatcaagagcgcc
tatcagcccgaacagctcgaaggcaagctgacggtgatggtggccaatctggcgccacgc
aagatgaaattcggcatcagcgaaggcatggtgctggccgccagccacgcggacgagaaa
gccaaccccggcatcttcgtgctggagcccttccccggtgcgcagccgggcatgcgggtg
cgctaa

DBGET integrated database retrieval system