KEGG   Paucibacter sp. KCTC 42545: AT984_10955Help
Entry
AT984_10955       CDS       T04227                                 

Definition
(GenBank) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00790  Folate biosynthesis
pkt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT984_10955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pkt04147]
    AT984_10955
Enzymes [BR:pkt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AT984_10955
Exosome [BR:pkt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT984_10955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a AveC_like
Motif
Other DBs
NCBI-ProteinID: ALT77626
UniProt: A0A0U3EIZ0
Position
2517759..2518124
Genome map
AA seq 121 aa AA seqDB search
MPSTIDLLSTNCQHALAALAPAAWPEWLALVPGWQLISADEQAQPASIEARFDFQDFDQT
MAFANAVAAIAKAQDHHPDMHISYKHCGLRFTTHSAGSLTVNDFICAARVNALRHVGGTS
A
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcaccatcgatttactgagcacaaactgccaacacgcgcttgccgcactggcc
cctgccgcttggcccgaatggctggccttggtgccgggttggcagctgatcagcgcagat
gagcaggcgcagccagccagcatcgaagcccgcttcgatttccaggattttgatcaaacc
atggctttcgccaacgccgtggccgcgattgccaaggcacaggaccatcaccccgatatg
cacatctcctacaagcactgcggcctgcgcttcacgacccattcggccgggagcctgacg
gtcaatgacttcatctgcgcggcgcgggtcaacgccctgcgccacgtcggcggcaccagc
gcatga

DBGET integrated database retrieval system