KEGG   Paucibacter sp. KCTC 42545: AT984_17920Help
Entry
AT984_17920       CDS       T04227                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00564  Glycerophospholipid metabolism
pkt01100  Metabolic pathways
pkt01110  Biosynthesis of secondary metabolites
Module
pkt_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT984_17920
Enzymes [BR:pkt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AT984_17920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ALT79989
UniProt: A0A0U2TK67
Position
4194736..4195563
Genome map
AA seq 275 aa AA seqDB search
MPKQALTWIAGKFASARLGGLTTSVIRRFVARYEVNMAEAANPDIASYASFNEFFTRALK
PGARPLAVAELICPVDGRISQFGRIEGEQIFQAKDHQFSTTALVGGDAALAAQFRDGLFA
NLYLSPRDYHRIHMPCDGRLLRMIHVPGELFSVNPVTAEGVPGLFARNERVVCVFEGSQG
PWIMVLVGATIVGSMATVWHGVVNPPRPGHLRDWQYADQNIVLKQGDELGRFLLGSTVVM
LFPKSQGDALSFNPAWQPAGPVRLGEVMATRSAAQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcaggcactgacctggatcgccggcaaattcgcctcggcccggctgggtggc
ttgaccaccagcgtgatccgccgcttcgtcgcccgctacgaagtcaatatggccgaagcg
gccaatcccgatatcgccagctacgcgagcttcaacgaattcttcacccgcgccctcaag
cccggcgcccgcccactggcggtggccgagttgatctgcccggtggatggccgcatcagc
caattcggccgcatcgagggcgagcagatttttcaggccaaggaccatcaattcagcacc
accgccttggtgggcggagacgcggcgctggcggcgcagttccgcgacggcctgttcgcc
aacctctacctcagcccacgcgactatcaccgcatccacatgccttgcgatggccgcctg
ctgcgcatgatccatgtgccgggcgagctgttctcggtcaacccggtcacggccgagggc
gtgccgggcctgttcgcgcgcaatgagcgcgtggtctgcgtgttcgagggctcgcaaggc
ccttggatcatggtgctggtcggtgccaccatcgtgggcagcatggccacggtatggcat
ggcgtggtcaacccgccgcgcccgggccatttgcgggactggcaatatgccgatcagaac
atcgtgctcaaacaaggcgatgagctgggccgcttcctgctgggctccaccgtggtgatg
ctcttccccaagtcgcagggcgatgccctgtccttcaacccggcgtggcagccggccggg
ccggtgcgcctgggtgaggtgatggcgacacgttcagcagctcaataa

DBGET integrated database retrieval system