KEGG   Planococcus kocurii: AUO94_00700Help
Entry
AUO94_00700       CDS       T04200                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pku  Planococcus kocurii
Pathway
pku00020  Citrate cycle (TCA cycle)
pku00620  Pyruvate metabolism
pku01100  Metabolic pathways
pku01110  Biosynthesis of secondary metabolites
pku01120  Microbial metabolism in diverse environments
pku01130  Biosynthesis of antibiotics
pku01200  Carbon metabolism
Module
pku_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pku_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AUO94_00700
   00620 Pyruvate metabolism
    AUO94_00700
Enzymes [BR:pku01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AUO94_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase TPP_enzyme_M HI0933_like MCRA Pyr_redox Pyr_redox_2 DUF2420
Motif
Other DBs
NCBI-ProteinID: ALS77250
UniProt: A0A0U2J847
Position
1866376..1867875
Genome map
AA seq 499 aa AA seqDB search
MDNQQKNKNVILIGAGVMSATLGAMLKELAPSWNIKVFEKLEKAGAESSNEWNNAGTGHA
ALCELNYTPEQADGSIDIKKASSINEQFQLSRQFWSFLVNHKRIANPQDFIMSIPHMSLV
QGEDNVRFLNNRFEALSKSPLFKGMEYSADLEKLKEWIPLIMEGRTSTEAMAATKIDTGT
DVNFGALTEMLFTHLEEQQVEMNYNHAVKDIKRSSDSTWEVKVQDLENNKIEYHNADFVF
IGGGGGSLPLLQKTGIPESKHIGGFPVSGLFLVCNDPEIVEQHHAKVYGKAKVGAPPMSV
PHLDTRFIDGKKSLLFGPFAGFSPKFLKTGSNMDLLGSVKPNNVFTMLAAGAKEMSLTKY
LVQQVLLSNEKRVEELREFIPTAKLADWDVVVAGQRVQVIKDTDKGKGTLQFGTEIVTSR
DGSVAALLGASPGASTAVHAMLEIFQRCFPDHVGEWEPKIKEMIPSYGISLAENPELLQE
IHTSTAKALQLDEKSPIGI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaacaaaaaaacaagaacgttatcttgatcggcgctggagttatgagcgcg
actttgggagcaatgcttaaagagttagcccctagctggaatattaaagtgtttgaaaaa
cttgaaaaagcaggagccgaaagttccaacgaatggaataacgctggaacaggacatgca
gcactttgcgagctgaactatacacctgaacaagctgacggctctatcgatataaaaaaa
gcgagtagcatcaatgaacagtttcagctttcgagacaattttggtcgtttcttgtaaat
cacaaacgcattgctaatccacaggactttattatgtcgattccgcacatgagtttggta
caaggagaagacaatgtacgtttcttaaacaaccgatttgaagcattatcaaaaagtcct
ttatttaaaggcatggaatattcagctgacctagaaaagttgaaagaatggattcccctt
attatggaaggtcgaacttcaactgaagccatggcggcaaccaaaattgatacgggtacg
gatgttaactttggtgctttaacggaaatgctgtttactcatttggaagagcaacaagtc
gaaatgaactacaaccatgcagttaaagacattaaacgtagtagtgatagcacgtgggaa
gtcaaagttcaggaccttgaaaacaacaaaattgagtaccataacgcggacttcgtcttt
atcggcggcggtggcggaagtttgcctttgcttcaaaagacgggtattcctgagtctaag
catattggcggcttcccggtgagtggcttgttcttagtttgcaacgatcctgaaattgta
gagcaacatcatgcaaaagtatatggaaaagcaaaagttggcgctccgccaatgtccgta
ccgcatttggatacacgctttattgacggcaagaaatcattattgttcggaccatttgca
ggattttcaccgaaattcctgaaaacaggctcaaacatggatttactcggttctgtaaaa
ccaaataacgtctttaccatgcttgctgcaggggcgaaagaaatgtcgttaacaaaatat
ttggttcagcaagtattgctgtccaatgaaaaacgtgtggaagaactgcgcgaatttatt
ccgactgccaaacttgcagactgggatgtagtagtcgcaggacagcgtgtacaagttatt
aaagatacggataaaggcaaaggaactcttcagtttggtacggaaattgttacttctagg
gacggttcggttgctgctttattaggcgcttcaccaggtgcatctacggctgttcatgcc
atgcttgaaattttccaaagatgttttccggatcatgtgggcgaatgggaaccgaagatc
aaagagatgattccgtcttacggcatctcgttggctgagaatcctgagcttcttcaagaa
atccatacttcaacagcaaaagcgttgcaattggatgaaaaaagcccaatcggaatttaa

DBGET integrated database retrieval system