KEGG   Planococcus kocurii: AUO94_03485Help
Entry
AUO94_03485       CDS       T04200                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pku  Planococcus kocurii
Pathway
pku00071  Fatty acid degradation
pku00072  Synthesis and degradation of ketone bodies
pku00280  Valine, leucine and isoleucine degradation
pku00310  Lysine degradation
pku00362  Benzoate degradation
pku00380  Tryptophan metabolism
pku00620  Pyruvate metabolism
pku00630  Glyoxylate and dicarboxylate metabolism
pku00640  Propanoate metabolism
pku00650  Butanoate metabolism
pku00900  Terpenoid backbone biosynthesis
pku01100  Metabolic pathways
pku01110  Biosynthesis of secondary metabolites
pku01120  Microbial metabolism in diverse environments
pku01130  Biosynthesis of antibiotics
pku01200  Carbon metabolism
pku01212  Fatty acid metabolism
pku02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUO94_03485
   00630 Glyoxylate and dicarboxylate metabolism
    AUO94_03485
   00640 Propanoate metabolism
    AUO94_03485
   00650 Butanoate metabolism
    AUO94_03485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUO94_03485
   00072 Synthesis and degradation of ketone bodies
    AUO94_03485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUO94_03485
   00310 Lysine degradation
    AUO94_03485
   00380 Tryptophan metabolism
    AUO94_03485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AUO94_03485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUO94_03485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AUO94_03485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pku04147]
    AUO94_03485
Enzymes [BR:pku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AUO94_03485
Exosome [BR:pku04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AUO94_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ALS77764
UniProt: A0A0U2ZF03
Position
2435755..2436948
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTAFGKFGGNLSTLTASDLGAEAIKAAMSRAAIQPEDVQEVIMGNVLQAG
QGQIPSRQAATKAGIPYNVKSETINKVCASGMRSVTLADQLIRLGDEEVIVAGGMESMSN
APYYLPKARWGLRMGDAQVVDGMVHDGLSCSFHPDRVHMGTYGNSTAEDFDLSREEQDEW
SARSHERAIKAKDLFAEEIVAIDIPQRKGDPITVDVDEAPRANSTIEALAKLKPAFGKDG
TITAGNAPGINDGAAALVLMSEERAQKEDKKVLAHILSHTEVAIEPHRFPETPGIVINEL
LKKTGKSLDDIDLFEINEAFAAVALASSKIAGLDAEKVNVNGGSVALGHPIGASGARIIL
TLAYELKRRGGGIGIAAICSGGGQGDAIMISVPKEEK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtcattatcgacggggcacgtacggcatttgggaaattcggaggtaac
ttgagtacgctaacagcaagtgaccttggagcagaagccatcaaagccgcgatgagccgt
gcagctattcaaccagaagacgttcaagaagtgatcatgggtaatgtgttgcaagcagga
caaggccaaattccttctcgtcaagctgcgacaaaagcagggattccatacaacgtaaaa
tctgaaacgatcaataaagtctgtgcatcgggtatgcgcagtgtcaccttagccgatcaa
cttatccgtttaggtgatgaagaagtcattgttgcaggtggcatggaatcgatgtccaat
gcaccttattatttaccaaaagcacgctggggtcttcgtatgggagacgctcaagtcgtc
gacggcatggttcatgacggtttgtcatgctcattccacccagaccgtgttcacatggga
acttacggcaactcaactgctgaagactttgacttgtctcgtgaagagcaagacgagtgg
tcagctcgttcgcatgaacgtgcgatcaaagcaaaagatttgtttgcagaagaaattgtg
gcaatcgacattccgcaacgcaaaggagatccaattacagttgatgtggatgaagctccg
cgcgccaattcaacaattgaagcattagcaaagctaaaaccagcattcggtaaagatggc
accattactgctggaaacgcacctggaattaatgacggagcggcggcacttgtcttaatg
agtgaagaacgagcacaaaaagaagacaaaaaagttttggctcacattctttcacataca
gaagtcgcaatcgaaccacatcgtttcccagaaactcctggaatcgtcatcaacgagcta
ttaaagaaaacaggtaaatcgttagacgacatcgatttattcgaaattaacgaagcgttt
gcagcagttgcattagcgagttcaaaaattgctgggcttgacgctgaaaaagtgaacgtc
aatggggggtctgtagcacttggtcacccaattggtgcaagtggtgcacgcattattctg
acactcgcttacgaattaaaacgtcgcggaggcggcatcggtatcgcagcaatctgctca
ggtggcggacaaggcgacgcgattatgatcagcgttcctaaggaggaaaaataa

DBGET integrated database retrieval system