KEGG   Planococcus kocurii: AUO94_05445Help
Entry
AUO94_05445       CDS       T04200                                 

Definition
(GenBank) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
pku  Planococcus kocurii
Pathway
pku00300  Lysine biosynthesis
pku01100  Metabolic pathways
pku01110  Biosynthesis of secondary metabolites
pku01230  Biosynthesis of amino acids
Module
pku_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AUO94_05445
Enzymes [BR:pku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     AUO94_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ALS78126
UniProt: A0A0U2Z2P6
Position
2878640..2879353
Genome map
AA seq 237 aa AA seqDB search
MKQMDATEIISYIQNAKKATPVKAYIKGQGVADLDYGTESKVFGQGNSVTVFGEWADIQT
ALEANAALIEDSVVENDRRNSAIPLLDMKNINSRIEPGAFIRENVEIGNNCIIMMGAVIN
IGAVIGDGTMIDMGVIMGGRATVGKNCHIGAGAVLAGVIEPASATPVIVEDDVMIGANAV
VLEGVRIGKGAVVAAGAIVIEDVPENSVVGGTPARVLKLMDEKTRSKTEIKHELRQL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatggatgcaactgaaataatctcgtacatacaaaatgcaaaaaaagcgaca
cccgtaaaagcgtacataaaaggtcaaggcgttgctgatttggattatggcacagagtcc
aaagttttcggacaaggcaattcagtaactgtattcggcgaatgggcagatattcaaacg
gcactagaagcaaatgctgcgctcatcgaagattctgtagtggaaaacgatcgtagaaat
tcagcgataccactattagatatgaaaaacatcaatagccgcattgaacccggtgcattt
atccgtgaaaatgtagaaatcggaaacaattgtatcattatgatgggtgctgtaattaat
attggtgctgttattggcgatggtacaatgatcgatatgggcgtaattatgggcggtcgg
gcgacagttggcaaaaactgccacatcggtgctggagcagtactagccggcgttatcgaa
ccggcatcagcaactcctgttatcgtcgaagacgatgttatgatcggcgccaacgcagtg
gttctcgaaggcgttcggattggtaaaggtgcagttgtcgcagcgggcgcaatcgtcatc
gaagatgtgcctgaaaactccgtagtgggcggcacaccagcgcgcgtattgaaattaatg
gacgaaaagactcgttcaaaaacagaaatcaaacacgaactaagacagctataa

DBGET integrated database retrieval system