KEGG   Planococcus kocurii: AUO94_06780Help
Entry
AUO94_06780       CDS       T04200                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
pku  Planococcus kocurii
Pathway
pku00230  Purine metabolism
pku00240  Pyrimidine metabolism
pku01100  Metabolic pathways
pku01110  Biosynthesis of secondary metabolites
pku01130  Biosynthesis of antibiotics
Module
pku_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pku_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
pku_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AUO94_06780
   00240 Pyrimidine metabolism
    AUO94_06780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pku04131]
    AUO94_06780
Enzymes [BR:pku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     AUO94_06780
Membrane trafficking [BR:pku04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    AUO94_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ALS78382
UniProt: A0A0U2Z3C4
Position
3148363..3148809
Genome map
AA seq 148 aa AA seqDB search
MEKTFLMVKPDGVQRNVIGEIVARFEKKGYHLVGAKLMQIPTELAEEHYGEHKERPFFGE
LVEFITSGPVFAMVWEGENVILTARQMMGATNPKDAASGTIRGDFAVTVGKNMIHGSDSA
ESAEREIGLFFKEEELVSYEKTMNNWVN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaacatttttaatggttaaaccagatggcgttcaacgcaacgtaatcggagaa
atcgtcgcacgtttcgagaaaaaaggatatcatttagtaggtgctaaattgatgcaaatt
cctactgagttggctgaagagcattacggcgagcacaaagagcgtcctttcttcggtgaa
ttggttgaatttatcacttcaggtcctgtattcgcaatggtttgggaaggcgaaaacgtt
attttgactgcacgtcaaatgatgggcgcgacaaacccgaaagatgcagcttcaggaact
atccgcggcgacttcgcagttactgtcggcaaaaacatgattcacggttcggattctgct
gaaagtgcagaacgcgagatcggcttgttcttcaaagaagaagaattggtttcatatgaa
aaaacaatgaacaactgggttaactaa

DBGET integrated database retrieval system