KEGG   Pichia kudriavzevii: C5L36_0A03270Help
Entry
C5L36_0A03270     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03252  translation initiation factor 3 subunit C
Organism
pkz  Pichia kudriavzevii
Pathway
pkz03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    C5L36_0A03270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pkz03012]
    C5L36_0A03270
Translation factors [BR:pkz03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    C5L36_0A03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI UN_NPL4
Motif
Other DBs
NCBI-GeneID: 40381435
NCBI-ProteinID: XP_029319202
Position
1:721370..724003
Genome map
AA seq 877 aa AA seqDB search
MSSFFYTSYDSESSSDEDTLYYSDDERYLEQKQKLEKSILITGDDESDSGEETMSESEEE
APKPQASAFLKSSSAEAESSEEEESDEDWSADSDSDSDSDVAPKGRNYFLKSDFLKGSTN
DSDDEENEKKVVKSAKEKYLDELADLTDKIENLSMVEEWVRLADEFDKLYKLSYKHNQYH
IPIPRSFIKALAILEDAIKNDSSAAPESTKKLSASESKSLNILKQKVKKEAKIYVDQLDI
YRKDPEAYEAGSNEPQLVADDLDSEKELSITHANLFSIVQSILETRGKKGVDINEQLSKL
SQLLQVAQMTYEKIVLLNLIISLRYELHTKDDYMPTGQWNLACQNINDLLDVLDNDKSFV
VTESAPTNDDITKTPPANSEGKHLVVGSVASHVERLADEFTTHLLYIDPNSSEYIAVLKD
EAKLYKTIVRTQIYLTQIISPSNYGDLEGDQLCRIVLKRLESIYFKPVQLIVLSELNVWN
SLVEEIYEFVPKISSESAESSNEQTNSLIDSLCSHLYQYSTGISSSISRKRAALMQAYYY
AASSQFFRARDILHLTHVQATIHTSEPGVQVLFNRAIVQLGLAAFRAGLIEEAQTILNEV
VTSPHTRDLLGQGKIYFSNSSNSSDPSSNEKGKFVPFHMHVNIELVDVVYYISSLFVEVP
SMALHSYQGSTTGAINAANAEAQASSQSGKKAVSRSFKRILDYTERQYFQGPAEETRDFV
FDAYDELVRFNWKKASEILTGLRVWGMMPGLSSTHVEGKSGAELLNQMLTETCKTEALKT
WVYVNGGIVKNYSVAKLASRFELAEEKVSSILGGLIYREEIRAHLKFNAKGNKLIVFEKK
EDGMSEIVRDLTDKVNSILERNEKLSSGGYQIMLKKK
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttttttctatacctcctatgattcggaatcatcttcggacgaagataccctc
tactattctgatgatgaacgttacttagagcaaaagcaaaaactggaaaagagcatccta
attacaggggatgatgaaagtgatagtggtgaggaaacaatgtctgaatcagaggaagaa
gcaccaaaaccacaggcttctgcatttctaaaatcgagctctgcagaagctgaatccagt
gaagaagaagagtctgatgaagattggagtgcagattctgactccgattctgattctgat
gttgcaccaaagggtagaaactacttcttgaaaagtgattttttgaaaggcagtaccaac
gattccgacgatgaagaaaacgaaaagaaggttgttaagtctgcaaaggagaaatacctt
gatgaattggctgatttgacagacaaaattgagaacttatcaatggttgaggaatgggtt
cgccttgccgatgaatttgataaactatacaaactttcttacaaacataaccagtatcat
atcccaattccaagatcttttattaaagcgcttgctattttagaggatgcaatcaaaaac
gattcttcagcagcacctgaatctacaaagaaattgagtgcaagcgaatctaagagtcta
aacattttaaaacaaaaggttaagaaagaagcgaagatctatgtcgaccaactcgacatc
tacagaaaagatccagaagcttacgaagcgggtagcaatgaaccacaattggttgcagat
gatttagattctgaaaaagaactttcaattactcatgctaacttgttctcaattgttcaa
tctattcttgaaaccagaggtaagaaaggtgttgacatcaatgaacagctctctaaatta
agtcaattactccaagttgcgcaaatgacatatgaaaagattgtccttcttaatctgatc
atctccttaagatatgaactacacactaaggatgattacatgccaactggtcaatggaac
ttggcttgtcaaaacatcaatgacttgttggatgttttagataatgataagtcttttgtt
gtcactgaaagtgcgccaactaatgatgatatcaccaaaacaccacctgcaaattctgaa
ggtaagcatttggttgttggttcagttgcttcacatgttgagagattggcagacgaattt
actactcatttattatacattgatcctaactcttctgaatacattgccgttctaaaggat
gaagccaagctctacaaaacaattgtcagaacacagatctatctaacacaaatcatctca
ccttcgaattacggagaccttgaaggtgatcagttgtgtcgtattgtactcaagaggcta
gagtctatatacttcaaacctgttcaattgattgttctctctgaattaaacgtttggaat
tccttagtcgaagagatatacgaatttgttccaaaaatatccagtgagtctgcagaatct
tccaatgaacagactaattcattaatagattctttatgttctcatttgtatcagtattct
actggtatttcttcatctatttccagaaaacgtgctgcattgatgcaagcatactactat
gcagcttcttcacagtttttccgtgcacgtgatatccttcacttgacccatgttcaagct
acaatccatacatctgaaccaggtgttcaagttttatttaatcgtgctattgttcaatta
ggtttggccgcattccgtgctggtttgattgaagaagcacaaactattttgaatgaagtt
gttaccagcccacatactagggatttattaggacaaggtaagatctacttctctaattca
agtaacagctcagatccaagctctaatgaaaaaggtaagtttgtgcccttccatatgcat
gttaatattgagttagttgatgtcgtttactacatttcctcgttatttgttgaagttcca
tcaatggcattgcattcttatcagggctccaccacaggtgctattaatgcagcaaatgca
gaggcacaggcttcatcgcaaagtggaaagaaggccgtttctagatcattcaagcgtatt
cttgactataccgaaaggcagtacttccaaggaccagctgaagaaaccagagactttgtc
tttgacgcttatgatgaattagttaggtttaattggaaaaaggcatcggaaatcctcacc
ggtttaagagtatggggtatgatgccaggtttatcttccacacatgttgagggcaaatca
ggtgcagaattattgaatcaaatgttaactgaaacttgtaagacagaagcattgaagaca
tgggtttacgttaacggtggcattgtaaagaactactcagtagcaaaattggcatccagg
tttgaacttgcagaagaaaaagtcagtagtattcttggtggtttaatttaccgtgaagag
atcagagcacatttgaagttcaatgctaaaggcaacaagttgattgtatttgaaaagaag
gaagatggtatgtctgaaattgtacgagacttaacagacaaggtcaactcaatcttagaa
cgtaatgagaaattaagctcaggtggttaccaaatcatgttaaagaagaaataa

DBGET integrated database retrieval system