KEGG   Pichia kudriavzevii: C5L36_0B04700
Entry
C5L36_0B04700     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00100  Steroid biosynthesis
pkz01100  Metabolic pathways
pkz01110  Biosynthesis of secondary metabolites
Module
pkz_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    C5L36_0B04700
Enzymes [BR:pkz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     C5L36_0B04700
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 40382984
NCBI-ProteinID: XP_029320696
Position
2:complement(974051..975370)
AA seq 439 aa
MSTLNPTTKEKEFGGAIGASILIVFLPLITLFLYLACNENYVMQGFQLDADAIKGVFCNQ
ILRNWQNVFFNSKCWAYYLAWFFSLAILDVYIPGTTKYGIELRDGTRLKYNINGLQLVGF
LLVLFISRFYLYGFNLFELDFLYDNFLGMMATSWEFSILLSFFVYFASFIPLRNKNGKGT
KERILSVNGNSQNFIGDWFMGRELNPRIGEWDIKLFCELRPGLLLWLLLNVSCMQRQYQK
LGYVTNSMFLINALQFIYIIDGVLNEEGCLTMIDITTDGFGFMLAFGDLCWVPFCYCLQA
RYLTLNIINLSALSCIIILSIMALGFYVFKASNNQKNNFRQNKLPHLKSIQTDRGTKLLI
EGWWGISQHINYFGDMLIALSWCLPTGFNTILTYFYVIYFSALLFHRQARDEEKCRSKYG
KYWDEYEKQVQYKIIPYIY
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcaacactcaatccaactactaaggagaaggagtttggtggggcaataggggcatct
attctcatagtattcttaccattaatcacattattcttatatttagcatgtaatgaaaat
tatgtcatgcaaggtttccaacttgatgctgatgctataaagggtgttttttgtaaccaa
atactacgaaattggcaaaatgtcttctttaattccaaatgttgggcttactatcttgca
tggtttttttcattggccattttagatgtgtacattcctggtacaactaagtatgggatt
gaattaagagatggcacaagactgaaatacaacattaacggcttacaattggtagggttt
ttgcttgttcttttcatatcacggttttatttgtacggcttcaacttgtttgaattggat
ttcctatacgataactttttaggtatgatggctacttcatgggagttttccatactcctg
agcttttttgtttattttgcctcatttattccgctcagaaataaaaacggaaaaggcacc
aaggaaagaatactaagtgttaatggcaattcccaaaacttcattggtgattggtttatg
ggtagagaattaaacccaagaattggtgaatgggacatcaagttgttttgtgagctaagg
cccggccttttgttatggcttttactaaatgtttcgtgtatgcaaagacagtaccagaag
ctaggttacgttactaattcgatgtttttaatcaatgcattacaatttatctacattatc
gatggcgtattgaacgaagaaggatgcctaacaatgattgacattacaacagatgggttt
ggatttatgctcgcatttggtgatttatgttgggttccgttctgctattgtctgcaagca
agatatctcactctaaatataatcaatttatctgctttgagttgcataatcattttatca
atcatggcacttggattctatgtctttaaagcatcaaataaccaaaaaaataattttagg
caaaacaaattaccgcacctgaaatccatacaaaccgatagaggtacaaaactacttatc
gaaggatggtgggggatttctcaacatatcaactattttggtgatatgttaattgccttg
agttggtgcctgcctactggttttaatacaattctaacttacttctacgttatttatttt
tcggccctattgttccatagacaggctagagatgaggaaaaatgtagaagcaagtatggt
aaatactgggatgagtacgaaaaacaagttcaatataaaatcataccctacatttactaa

DBGET integrated database retrieval system