KEGG   Pichia kudriavzevii: C5L36_0C00700Help
Entry
C5L36_0C00700     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16944  septin 7
Organism
pkz  Pichia kudriavzevii
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pkz04131]
    C5L36_0C00700
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pkz04812]
    C5L36_0C00700
   04147 Exosome [BR:pkz04147]
    C5L36_0C00700
Membrane trafficking [BR:pkz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    C5L36_0C00700
Cytoskeleton proteins [BR:pkz04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     C5L36_0C00700
Exosome [BR:pkz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C5L36_0C00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Septin MMR_HSR1 AAA_22 AAA_14 Roc AAA_16 RsgA_GTPase GTP_EFTU AAA_24
Motif
Other DBs
NCBI-GeneID: 40383921
NCBI-ProteinID: XP_029321603
Position
3:118298..119707
Genome map
AA seq 469 aa AA seqDB search
MTDVAVTQHMGELSLDAHSNQSSVHNLPLHSVIEDNKSNSSKIIRRKLNGYVGFANLPKQ
WHRKSIRRGFNFNLMVVGEKGLGKSTLVNTLFNRDLYDLNNSKAYQIDLDNTEDQIKIET
LNTEIEENNVKLNLQVIDCTGFGDSIDHTNSVKPIIDEIDSRFDSYLEMETKINRSSLAI
KDNRIHALLYFIEPTGHCLKPLDINFMKQVHEKVNLIPIIAKSDILTDLEVEDFKQKIVQ
DLQNQNIKFFSPKIYENDDQETRLTNNEIISKIPYAIVGSNQLIKLNDGRLVRGRSYPWG
IVEVDNELHCDFVKLRQLLIRNSMEELKEITNKKLYENYRLEKLSKMGIKQDDSVFKEFD
PVLKQEEEKRLHEAKLLNLEKQMKEIFQQKVSREEKKLQETEADLFSKHKEMRDKLLKQI
KMLEDKKKELEASANFVDHSSQQHQIQQQIQQQQQQQQPTKTKKGFLRG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgttgcagtgacacagcacatgggcgagctctctctcgatgcacattccaac
caatcttctgtccacaatcttccactgcattctgtaattgaggacaacaaaagcaacagt
tccaaaatcatccgtaggaagctcaatggatacgttggctttgcaaacttgcctaaacaa
tggcatagaaagtcgatcagaaggggcttcaatttcaacctcatggttgttggtgagaaa
ggtcttggtaaatcgacacttgttaataccctattcaacagggatttatatgacttgaat
aattcaaaagcttaccaaatcgacctggacaatactgaggaccaaatcaaaattgaaact
ctcaatactgaaatcgaggaaaacaacgttaaattgaatttacaagtgattgattgtact
ggatttggagattctattgatcatacaaactccgtcaaaccaattattgatgaaatcgat
tcgaggtttgactcatatttggaaatggagaccaaaatcaatagatcatctttagctatt
aaagataatagaatccatgctttgttgtattttatcgaaccaactggacattgcttgaaa
cctttagatattaattttatgaaacaagtccatgaaaaggtcaatttgattccaatcatt
gccaaatcggatattctaaccgatttggaagttgaagatttcaaacaaaagattgttcaa
gatcttcaaaatcaaaatatcaaattcttcagcccaaaaatttatgaaaatgatgatcaa
gaaactagattgactaataatgaaattatttccaagatcccgtatgccattgttggctcg
aaccagttgatcaaattgaatgatggtagactggttagaggtagaagttatccttggggg
attgttgaggttgacaatgagttacattgtgattttgtaaaattgagacaattactaatt
agaaattctatggaagaactgaaagaaataaccaataagaaattatatgaaaattataga
cttgagaaattatctaaaatgggtattaaacaagacgattcagttttcaaagaattcgac
ccagtcttaaaacaagaagaagaaaagaggttgcatgaggcaaaattgttaaacttggaa
aaacaaatgaaggagatcttccagcaaaaagttagcagggaggagaaaaagctacaagaa
actgaagctgatttgttcagcaaacataaagaaatgagagacaagttgctaaaacaaata
aaaatgttagaagataaaaagaaagaattggaggcaagtgctaactttgttgaccattct
tcacagcagcatcaaattcagcaacagattcaacaacaacaacaacaacaacaaccaacg
aaaactaagaaagggttcttacgtggctag

DBGET integrated database retrieval system